Search Antibody, Protein, and ELISA Kit Solutions

Alx4 Antibody - middle region (ARP36820_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP36820_P050-FITC Conjugated

ARP36820_P050-HRP Conjugated

ARP36820_P050-Biotin Conjugated

Tested Species Reactivity:
Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Alx4
Official Gene Full Name:
Aristaless-like homeobox 4
NCBI Gene Id:
11695
Protein Name:
Homeobox protein aristaless-like 4
Swissprot Id:
O35137
Protein Accession #:
NP_031468
Nucleotide Accession #:
NM_007442
Alias Symbols:
lst
Replacement Item:
This antibody may replace item sc-126413 from Santa Cruz Biotechnology.
Description of Target:
Alx4 is a transcription factor involved in skull and limb development.
Protein Size (# AA):
399
Molecular Weight:
43
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Alx4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Alx4.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of mouse Alx4
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 79%; Human: 86%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-Alx4 (ARP36820_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EPELPPDSEPVGMDNSYLSVKETGAKGPQDRASAEIPSPLEKTDSESNKG
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Sox10; Gtf3c1; Med16; Tle6; Ercc8; Tbx21; Mixl1; Sox2; Sox15; Rax; Pou4f2; Pou3f4; Prrx1; Pax3; Otx2; Lmx1b; Ldb1; Hoxd13; Hoxd12; Hoxc4; Hoxb13; Hoxa11; Hoxa10; Foxa1; Foxh1; Dlx5; Dlx2; Dlx1; Cdx4; Cdx2; Cdx1; Alx4;
Blocking Peptide:
For anti-Alx4 (ARP36820_P050) antibody is Catalog # AAP36820 (Previous Catalog # AAPP08694)
Datasheets/Manuals:
Printable datasheet for anti-Alx4 (ARP36820_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...