ALPP Antibody - C-terminal region (ARP41959_T100)

Catalog No: ARP41959_T100

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/mL of the antibody was used in this experiment.

WB Suggested Anti-ALPP Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate

Rabbit Anti-ALPP Antibody
Catalog Number: ARP41959
Paraffin Embedded Tissue: Human Lung
Cellular Data: Alveolar cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ALPP
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 79%; Rabbit: 79%; Rat: 79%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: TVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-ALPP (ARP41959_T100) antibody is Catalog # AAP41959 (Previous Catalog # AAPP24495)
• Enhanced Validation:

  Relative Expression (Western Blot)

• Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Target Info

• Gene Symbol: ALPP
• Gene Full Name: Alkaline phosphatase, placental
• Alias Symbols: ALP, IAP, ALPI, PALP, PLAP, PLAP-1
• NCBI Gene Id: 250
• Protein Name: Alkaline phosphatase, placental type
• Description of Target: There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2 while the tissue non-specific form is located on chromosome 1. ALPP is a membrane bound glycosylated enzyme, also referred to as the heat stable form, that is expressed primarily in the placenta although it is closely related to the intestinal form of the enzyme as well as to the placental-like form.There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2 while the tissue non-specific form is located on chromosome 1. The product of this gene is a membrane bound glycosylated enzyme, also referred to as the heat stable form, that is expressed primarily in the placenta although it is closely related to the intestinal form of the enzyme as well as to the placental-like form. The coding sequence for this form of alkaline phosphatase is unique in that the 3' untranslated region contains multiple copies of an Alu family repeat. In addition, this gene is polymorphic and three common alleles (type 1, type 2 and type 3) for this form of alkaline phosphatase have been well characterized.
• Uniprot ID: P05187
• Protein Accession #: NP_001623
• Nucleotide Accession #: NM_001632
• Protein Size (# AA): 535
• Molecular Weight: 58 kDa
• Protein Interactions: COL2A1; KRTAP10-3; KRTAP4-12; KRTAP5-9; RPA3; RPA2; RPA1; FBXO6; LATS1; UBC; SUMO1; SUMO2; UBXN6; Cep76; Trim69; Erh; Cbx1; UBXN11; ASPSCR1; NSFL1C; UBXN1; UBXN7; FAF2; FAF1; ALPP; PIGK; GPLD1;