Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP56030_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP56030_P050-FITC Conjugated

ARP56030_P050-HRP Conjugated

ARP56030_P050-Biotin Conjugated

ALOX15 Antibody - middle region (ARP56030_P050)

Catalog#: ARP56030_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-105003 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ALOX15
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 93%; Human: 100%; Mouse: 85%; Pig: 100%; Rabbit: 100%; Rat: 85%
Complete computational species homology data Anti-ALOX15 (ARP56030_P050)
Peptide Sequence Synthetic peptide located within the following region: QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ALOX15 (ARP56030_P050) antibody is Catalog # AAP56030 (Previous Catalog # AAPP37435)
Datasheets/Manuals Printable datasheet for anti-ALOX15 (ARP56030_P050) antibody
Target Reference McCaskie,P.A., (2008) Hum. Genet. 123 (5), 445-453
Publications

Wieczfinska, J; Kacprzak, D; Pospiech, K; Sokolowska, M; Nowakowska, M; Pniewska, E; Bednarek, A; Kuprys-Lipinska, I; Kuna, P; Pawliczak, R; The whole-genome expression analysis of peripheral blood mononuclear cells from aspirin sensitive asthmatics versus aspirin tolerant patients and healthy donors after in vitro aspirin challenge. 16, 147 (2015). WB, Cow, Dog, Human, Mouse, Pig, Rabbit, Rat 26646719

Gene Symbol ALOX15
Official Gene Full Name Arachidonate 15-lipoxygenase
Alias Symbols 15-LOX2, 15LOX-1, 15-LOX-1
NCBI Gene Id 246
Protein Name Arachidonate 15-lipoxygenase
Description of Target ALOX15 converts arachidonic acid to 15S-hydroperoxyeicosatetraenoic acid. ALOX15 also acts on C-12 of arachidonate as well as on linoleic acid.
Swissprot Id P16050
Protein Accession # NP_001131
Nucleotide Accession # NM_001140
Protein Size (# AA) 662
Molecular Weight 73kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ALOX15.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ALOX15.
  1. What is the species homology for "ALOX15 Antibody - middle region (ARP56030_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "ALOX15 Antibody - middle region (ARP56030_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ALOX15 Antibody - middle region (ARP56030_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ALOX15 Antibody - middle region (ARP56030_P050)"?

    This target may also be called "15-LOX2, 15LOX-1, 15-LOX-1" in publications.

  5. What is the shipping cost for "ALOX15 Antibody - middle region (ARP56030_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ALOX15 Antibody - middle region (ARP56030_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ALOX15 Antibody - middle region (ARP56030_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "73kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ALOX15 Antibody - middle region (ARP56030_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ALOX15"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ALOX15"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ALOX15"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ALOX15"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ALOX15"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ALOX15"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ALOX15 Antibody - middle region (ARP56030_P050)
Your Rating
We found other products you might like!