Search Antibody, Protein, and ELISA Kit Solutions

ALOX15 Antibody - middle region (ARP56030_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP56030_P050-FITC Conjugated

ARP56030_P050-HRP Conjugated

ARP56030_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
ALOX15
Official Gene Full Name:
Arachidonate 15-lipoxygenase
NCBI Gene Id:
246
Protein Name:
Arachidonate 15-lipoxygenase
Swissprot Id:
P16050
Protein Accession #:
NP_001131
Nucleotide Accession #:
NM_001140
Alias Symbols:
15-LOX2, 15LOX-1, 15-LOX-1
Replacement Item:
This antibody may replace item sc-105003 from Santa Cruz Biotechnology.
Description of Target:
ALOX15 converts arachidonic acid to 15S-hydroperoxyeicosatetraenoic acid. ALOX15 also acts on C-12 of arachidonate as well as on linoleic acid.
Protein Size (# AA):
662
Molecular Weight:
73kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ALOX15.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ALOX15.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human ALOX15
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 93%; Human: 100%; Mouse: 85%; Pig: 100%; Rabbit: 100%; Rat: 85%
Complete computational species homology data:
Anti-ALOX15 (ARP56030_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASL
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ALOX15 (ARP56030_P050) antibody is Catalog # AAP56030 (Previous Catalog # AAPP37435)
Datasheets/Manuals:
Printable datasheet for anti-ALOX15 (ARP56030_P050) antibody
Target Reference:
McCaskie,P.A., (2008) Hum. Genet. 123 (5), 445-453
Publications:

Wieczfinska, J; Kacprzak, D; Pospiech, K; Sokolowska, M; Nowakowska, M; Pniewska, E; Bednarek, A; Kuprys-Lipinska, I; Kuna, P; Pawliczak, R; The whole-genome expression analysis of peripheral blood mononuclear cells from aspirin sensitive asthmatics versus aspirin tolerant patients and healthy donors after in vitro aspirin challenge. 16, 147 (2015). WB, Cow, Dog, Human, Mouse, Pig, Rabbit, Rat 26646719

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...