Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP56030_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP56030_P050-FITC Conjugated

ARP56030_P050-HRP Conjugated

ARP56030_P050-Biotin Conjugated

ALOX15 Antibody - middle region (ARP56030_P050)

Catalog#: ARP56030_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-105003 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ALOX15
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 93%; Human: 100%; Mouse: 85%; Pig: 100%; Rabbit: 100%; Rat: 85%
Complete computational species homology data Anti-ALOX15 (ARP56030_P050)
Peptide Sequence Synthetic peptide located within the following region: QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ALOX15 (ARP56030_P050) antibody is Catalog # AAP56030 (Previous Catalog # AAPP37435)
Datasheets/Manuals Printable datasheet for anti-ALOX15 (ARP56030_P050) antibody
Target Reference McCaskie,P.A., (2008) Hum. Genet. 123 (5), 445-453
Publications

Wieczfinska, J; Kacprzak, D; Pospiech, K; Sokolowska, M; Nowakowska, M; Pniewska, E; Bednarek, A; Kuprys-Lipinska, I; Kuna, P; Pawliczak, R; The whole-genome expression analysis of peripheral blood mononuclear cells from aspirin sensitive asthmatics versus aspirin tolerant patients and healthy donors after in vitro aspirin challenge. 16, 147 (2015). WB, Cow, Dog, Human, Mouse, Pig, Rabbit, Rat 26646719

Gene Symbol ALOX15
Official Gene Full Name Arachidonate 15-lipoxygenase
Alias Symbols 15-LOX2, 15LOX-1, 15-LOX-1
NCBI Gene Id 246
Protein Name Arachidonate 15-lipoxygenase
Description of Target ALOX15 converts arachidonic acid to 15S-hydroperoxyeicosatetraenoic acid. ALOX15 also acts on C-12 of arachidonate as well as on linoleic acid.
Swissprot Id P16050
Protein Accession # NP_001131
Nucleotide Accession # NM_001140
Protein Size (# AA) 662
Molecular Weight 73kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ALOX15.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ALOX15.
Write Your Own Review
You're reviewing:ALOX15 Antibody - middle region (ARP56030_P050)
Your Rating