Search Antibody, Protein, and ELISA Kit Solutions

ALOX12B Antibody - C-terminal region (ARP91925_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
ALOX12B
Official Gene Full Name:
arachidonate 12-lipoxygenase, 12R type
NCBI Gene Id:
11686
Protein Name:
Arachidonate 12-lipoxygenase, 12R-type
Swissprot Id:
O70582
Protein Accession #:
NP_033789.1
Nucleotide Accession #:
NM_009659.2
Alias Symbols:
Aloxe2, e-LOX2, 12R-LOX
Description of Target:
This gene encodes an enzyme involved in the conversion of arachidonic acid to 12R-hydroxyeicosatetraenoic acid. Mutations in this gene can prevent the formation of the epidermal permeability barrier and cause an ichthyosiform phenotype.
Protein Size (# AA):
701
Molecular Weight:
81 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ALOX12B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ALOX12B.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of mouse ALOX12B
Predicted Species Reactivity:
Mouse
Tested Species Reactivity:
Mouse
Peptide Sequence:
Synthetic peptide located within the following region: GLTTLQTYMDTLPDVKTTCIVLLVLWTLCREPDDRRPLGHFPDIHFVEEG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ALOX12B (ARP91925_P050) antibody is Catalog # ARP91925_P050
Datasheets/Manuals:
Printable datasheet for anti-ALOX12B (ARP91925_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...