Allergen Bla g 4 Recombinant Protein (German cockroach) (OPCA03489)

Catalog No: OPCA03489

Bla g 4 Recombinant Protein (Blattella germanica ) (OPCA03489) in SDS-PAGE showing the molecular weight of approximately 21.78 kDa.

Product Info

• Predicted Species Reactivity: Blattella germanica
• Product Format: Liquid or Lyophilized powder
• Host: Blattella germanica
• Additional Information: Relevance: Probable ligand-binding protein.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: NEDCFRHESLVPNLDYERFRGSWIIAAGTSEALTQYKCWIDRFSYDDALVSKYTDSQGKNRTTIRGRTKFEGNKFTIDYNDKGKAFSAPYSVLATDYENYAIVEGCPAAANGHVIYVQIRFSVRRFHPKLGDKEMIQHYTLDQVNQHKKAIEEDLKHFNLKYEDLHSTCH
• Protein Sequence: NEDCFRHESLVPNLDYERFRGSWIIAAGTSEALTQYKCWIDRFSYDDALVSKYTDSQGKNRTTIRGRTKFEGNKFTIDYNDKGKAFSAPYSVLATDYENYAIVEGCPAAANGHVIYVQIRFSVRRFHPKLGDKEMIQHYTLDQVNQHKKAIEEDLKHFNLKYEDLHSTCH
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 13-182 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Cloning of cockroach allergen, Bla g 4, identifies ligand binding proteins (or calycins) as a cause of IgE antibody responses.Arruda L.K., Vailes L.D., Hayden M.L., Benjamin D.C., Chapman M.D.J. Biol. Chem. 270:31196-31201(1995)
• Alias Symbols: Allergen Bla g IV.
• Protein Name: Allergen Bla g 4
• Description of Target: Probable ligand-binding protein.
• Uniprot ID: P54962
• Protein Size (# AA): Recombinant
• Molecular Weight: 21.8 kDa