ALG2 Antibody - C-terminal region (ARP48974_P050)

Catalog No: ARP48974_P050

WB Suggested Anti-ALG2 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ALG2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: QSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQC
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ALG2 (ARP48974_P050) antibody is Catalog # AAP48974 (Previous Catalog # AAPY02114)
• Reference: Draeby,I., (2007) Arch. Biochem. Biophys. 467 (1), 87-94
• Publications:

  Cossins, J. et al. Congenital myasthenic syndromes due to mutations in ALG2 and ALG14. Brain 136, 944-56 (2013). 23404334

  Novel pathogenic ALG2 mutation causing congenital myasthenic syndrome: A case report. Neuromuscul Disord. (2021). 34980536

  Rind, N. et al. A severe human metabolic disease caused by deficiency of the endoplasmatic mannosyltransferase hALG11 leads to congenital disorder of glycosylation-Ip. Hum. Mol. Genet. 19, 1413-24 (2010). 20080937

• Description:
  View product citations for ALG2 Antibody - C-terminal region (ARP48974_P050) on CiteAb

Target Info

• Gene Symbol: ALG2
• Gene Full Name: Asparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog (S. cerevisiae)
• Alias Symbols: CDG1I, CDGIi, CMS14, NET38, CMSTA3, hALPG2
• NCBI Gene Id: 85365
• Protein Name: Alpha-1,3/1,6-mannosyltransferase ALG2
• Description of Target: ALG2 is a member of the glycosyltransferase 1 family. It acts as an alpha 1,3 mannosyltransferase, mannosylating Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. Defects in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ii).This gene encodes a member of the glycosyltransferase 1 family. The encoded protein acts as an alpha 1,3 mannosyltransferase, mannosylating Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. Defects in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ii). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q9H553
• Protein Accession #: NP_149078
• Nucleotide Accession #: NM_033087
• Protein Size (# AA): 416
• Molecular Weight: 47kDa
• Protein Interactions: UBC; PLSCR3; SHISA5; PDCD6IP; ALG2; VPS28; PTPN23; SEC31A; TSG101; LAMP1; HSP90AA1; PTK2B; ANXA11; ANXA7; VPS37A; PEF1; SRI;