Loading...
Catalog No: ARP48974_P050
Price: $0.00
SKU
ARP48974_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ALG2 (ARP48974_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human ALG2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: QSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQC
Concentration0.5 mg/ml
Blocking PeptideFor anti-ALG2 (ARP48974_P050) antibody is Catalog # AAP48974 (Previous Catalog # AAPY02114)
ReferenceDraeby,I., (2007) Arch. Biochem. Biophys. 467 (1), 87-94
Publications

Cossins, J. et al. Congenital myasthenic syndromes due to mutations in ALG2 and ALG14. Brain 136, 944-56 (2013). 23404334

Novel pathogenic ALG2 mutation causing congenital myasthenic syndrome: A case report. Neuromuscul Disord. (2021). 34980536

Rind, N. et al. A severe human metabolic disease caused by deficiency of the endoplasmatic mannosyltransferase hALG11 leads to congenital disorder of glycosylation-Ip. Hum. Mol. Genet. 19, 1413-24 (2010). 20080937

Description
Gene SymbolALG2
Gene Full NameAsparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog (S. cerevisiae)
Alias SymbolsCDG1I, CDGIi, CMS14, NET38, CMSTA3, hALPG2
NCBI Gene Id85365
Protein NameAlpha-1,3/1,6-mannosyltransferase ALG2
Description of TargetALG2 is a member of the glycosyltransferase 1 family. It acts as an alpha 1,3 mannosyltransferase, mannosylating Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. Defects in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ii).This gene encodes a member of the glycosyltransferase 1 family. The encoded protein acts as an alpha 1,3 mannosyltransferase, mannosylating Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. Defects in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ii). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ9H553
Protein Accession #NP_149078
Nucleotide Accession #NM_033087
Protein Size (# AA)416
Molecular Weight47kDa
Protein InteractionsUBC; PLSCR3; SHISA5; PDCD6IP; ALG2; VPS28; PTPN23; SEC31A; TSG101; LAMP1; HSP90AA1; PTK2B; ANXA11; ANXA7; VPS37A; PEF1; SRI;
  1. What is the species homology for "ALG2 Antibody - C-terminal region (ARP48974_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish".

  2. How long will it take to receive "ALG2 Antibody - C-terminal region (ARP48974_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ALG2 Antibody - C-terminal region (ARP48974_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ALG2 Antibody - C-terminal region (ARP48974_P050)"?

    This target may also be called "CDG1I, CDGIi, CMS14, NET38, CMSTA3, hALPG2" in publications.

  5. What is the shipping cost for "ALG2 Antibody - C-terminal region (ARP48974_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ALG2 Antibody - C-terminal region (ARP48974_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ALG2 Antibody - C-terminal region (ARP48974_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "47kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ALG2 Antibody - C-terminal region (ARP48974_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ALG2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ALG2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ALG2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ALG2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ALG2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ALG2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ALG2 Antibody - C-terminal region (ARP48974_P050)
Your Rating