Search Antibody, Protein, and ELISA Kit Solutions

ALG11 Antibody - C-terminal region (ARP44463_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP44463_P050-FITC Conjugated

ARP44463_P050-HRP Conjugated

ARP44463_P050-Biotin Conjugated

Gene Symbol:
ALG11
Official Gene Full Name:
Asparagine-linked glycosylation 11, alpha-1,2-mannosyltransferase homolog (yeast)
NCBI Gene Id:
440138
Protein Name:
GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase
Swissprot Id:
Q2TAA5
Protein Accession #:
NP_001004127
Nucleotide Accession #:
NM_001004127
Alias Symbols:
GT8, KIAA0266, CDG1P
Replacement Item:
This antibody may replace item sc-105053 from Santa Cruz Biotechnology.
Description of Target:
The function remains unknown.
Protein Size (# AA):
492
Molecular Weight:
56kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ALG11.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ALG11.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human ALG11
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 86%; Guinea Pig: 93%; Horse: 100%; Human: 93%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Yeast: 92%; Zebrafish: 91%
Complete computational species homology data:
Anti-ALG11 (ARP44463_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LHTMWNEHFGIGVVECMAAGTIILAHNSGGPKLDIVIPHEGDITGFLAES
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC;
Blocking Peptide:
For anti-ALG11 (ARP44463_P050) antibody is Catalog # AAP44463 (Previous Catalog # AAPP25773)
Datasheets/Manuals:
Printable datasheet for anti-ALG11 (ARP44463_P050) antibody
Target Reference:
Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
Publications:

Rind, N. et al. A severe human metabolic disease caused by deficiency of the endoplasmatic mannosyltransferase hALG11 leads to congenital disorder of glycosylation-Ip. Hum. Mol. Genet. 19, 1413-24 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 20080937

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...