Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any help please email info@avivasysbio.com

Catalog No: ARP44463_P050
Price: $0.00
SKU
ARP44463_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ALG11 (ARP44463_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human ALG11
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 86%; Guinea Pig: 93%; Horse: 100%; Human: 93%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Yeast: 92%; Zebrafish: 91%
Peptide SequenceSynthetic peptide located within the following region: LHTMWNEHFGIGVVECMAAGTIILAHNSGGPKLDIVIPHEGDITGFLAES
Concentration0.5 mg/ml
Blocking PeptideFor anti-ALG11 (ARP44463_P050) antibody is Catalog # AAP44463 (Previous Catalog # AAPP25773)
ReferenceStrausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
Publications

Rind, N. et al. A severe human metabolic disease caused by deficiency of the endoplasmatic mannosyltransferase hALG11 leads to congenital disorder of glycosylation-Ip. Hum. Mol. Genet. 19, 1413-24 (2010). 20080937

Gene SymbolALG11
Gene Full NameAsparagine-linked glycosylation 11, alpha-1,2-mannosyltransferase homolog (yeast)
Alias SymbolsGT8, CDG1P
NCBI Gene Id440138
Protein NameGDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase
Description of TargetThe function remains unknown.
Uniprot IDQ2TAA5
Protein Accession #NP_001004127
Nucleotide Accession #NM_001004127
Protein Size (# AA)492
Molecular Weight56kDa
Protein InteractionsUBC;
  1. What is the species homology for "ALG11 Antibody - C-terminal region (ARP44463_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish".

  2. How long will it take to receive "ALG11 Antibody - C-terminal region (ARP44463_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ALG11 Antibody - C-terminal region (ARP44463_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ALG11 Antibody - C-terminal region (ARP44463_P050)"?

    This target may also be called "GT8, CDG1P" in publications.

  5. What is the shipping cost for "ALG11 Antibody - C-terminal region (ARP44463_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ALG11 Antibody - C-terminal region (ARP44463_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ALG11 Antibody - C-terminal region (ARP44463_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "56kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ALG11 Antibody - C-terminal region (ARP44463_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ALG11"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ALG11"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ALG11"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ALG11"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ALG11"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ALG11"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ALG11 Antibody - C-terminal region (ARP44463_P050)
Your Rating