Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP44463_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP44463_P050-FITC Conjugated

ARP44463_P050-HRP Conjugated

ARP44463_P050-Biotin Conjugated

ALG11 Antibody - C-terminal region (ARP44463_P050)

Catalog#: ARP44463_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-105053 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ALG11
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 86%; Guinea Pig: 93%; Horse: 100%; Human: 93%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Yeast: 92%; Zebrafish: 91%
Complete computational species homology data Anti-ALG11 (ARP44463_P050)
Peptide Sequence Synthetic peptide located within the following region: LHTMWNEHFGIGVVECMAAGTIILAHNSGGPKLDIVIPHEGDITGFLAES
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ALG11 (ARP44463_P050) antibody is Catalog # AAP44463 (Previous Catalog # AAPP25773)
Datasheets/Manuals Printable datasheet for anti-ALG11 (ARP44463_P050) antibody
Target Reference Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
Publications

Rind, N. et al. A severe human metabolic disease caused by deficiency of the endoplasmatic mannosyltransferase hALG11 leads to congenital disorder of glycosylation-Ip. Hum. Mol. Genet. 19, 1413-24 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 20080937

Gene Symbol ALG11
Official Gene Full Name Asparagine-linked glycosylation 11, alpha-1,2-mannosyltransferase homolog (yeast)
Alias Symbols GT8, KIAA0266, CDG1P
NCBI Gene Id 440138
Protein Name GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase
Description of Target The function remains unknown.
Swissprot Id Q2TAA5
Protein Accession # NP_001004127
Nucleotide Accession # NM_001004127
Protein Size (# AA) 492
Molecular Weight 56kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ALG11.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ALG11.
Protein Interactions UBC;
Write Your Own Review
You're reviewing:ALG11 Antibody - C-terminal region (ARP44463_P050)
Your Rating