Search Antibody, Protein, and ELISA Kit Solutions

ALF Antibody - N-terminal region (ARP32837_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32837_P050-FITC Conjugated

ARP32837_P050-HRP Conjugated

ARP32837_P050-Biotin Conjugated

Gene Symbol:
GTF2A1L
Official Gene Full Name:
General transcription factor IIA, 1-like
NCBI Gene Id:
11036
Protein Name:
TFIIA-alpha and beta-like factor
Swissprot Id:
Q9UNN4
Protein Accession #:
NP_751946
Nucleotide Accession #:
NM_172196
Alias Symbols:
ALF
Replacement Item:
This antibody may replace item sc-130304 from Santa Cruz Biotechnology.
Description of Target:
The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involves the effects of TFIIA on the interaction between TATA-binding protein (TBP) and DNA. ALF is a germ cell-specific counterpart of the large (alpha/beta) subunit of general transcription factor TFIIA that is able to stabilize the binding of TBP to DNA and may be uniquely important to testis biology.
Protein Size (# AA):
453
Molecular Weight:
50kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ALF.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ALF.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human ALF
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 92%; Guinea Pig: 83%; Horse: 100%; Human: 100%; Rabbit: 91%; Rat: 100%
Complete computational species homology data:
Anti-ALF (ARP32837_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VIPAGRTLPSFTTAELGTSNSSANFTFPGYPIHVPAGVTLQTVSGHLYKV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
GAB1; NKX2-3; ZBTB3; TLX3; MAFF; RBFOX2; HMG20A; PAX9; SIX6; MAFG; HOXC11; HOXC9; HOXA5; TLX2; EMX2; EMX1; CEBPE; ATF4; ASCL3; GTF2A2; SUB1; ID3; CSNK2A2; CSNK2A1; TBP;
Blocking Peptide:
For anti-GTF2A1L (ARP32837_P050) antibody is Catalog # AAP32837 (Previous Catalog # AAPP03857)
Datasheets/Manuals:
Printable datasheet for anti-GTF2A1L (ARP32837_P050) antibody
Target Reference:
Upadhyaya,A.B., et al., (2002) J. Biol. Chem. 277 (37), 34208-34216

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...