Search Antibody, Protein, and ELISA Kit Solutions

ALDOA Antibody - N-terminal region : FITC (ARP75898_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75898_P050 Unconjugated

ARP75898_P050-HRP Conjugated

ARP75898_P050-Biotin Conjugated

Gene Symbol:
ALDOA
NCBI Gene Id:
226
Swissprot Id:
P04075
Protein Accession #:
NP_908932
Alias Symbols:
ALDOA, ALDA,
Replacement Item:
This antibody may replace item sc-112196 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene, Aldolase A (fructose-bisphosphate aldolase), is a glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Three aldolase isozymes (A, B, and C), encoded by three different genes, are differentially expressed during development. Aldolase A is found in the developing embryo and is produced in even greater amounts in adult muscle. Aldolase A expression is repressed in adult liver, kidney and intestine and similar to aldolase C levels in brain and other nervous tissue. Aldolase A deficiency has been associated with myopathy and hemolytic anemia. Alternative splicing and alternative promoter usage results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 3 and 10.
Protein Size (# AA):
364
Molecular Weight:
40kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ALDOA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ALDOA.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ALDOA
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: CIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Blocking Peptide:
For anti-ALDOA (ARP75898_P050-FITC) antibody is Catalog # AAP75898
Datasheets/Manuals:
Printable datasheet for anti-ALDOA (ARP75898_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...