ALDH3B2 Antibody - N-terminal region (ARP62749_P050)

Catalog No: ARP62749_P050

WB Suggested Anti-ALDH3B2 Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Liver

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 79%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Rat: 86%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: LTLVLLVGALAAGSCVVLKPSEISQGTEKVLAEVLPQYLDQSCFAVVLGG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ALDH3B2 (ARP62749_P050) antibody is Catalog # AAP62749

Target Info

• Gene Symbol: ALDH3B2
• Gene Full Name: Aldehyde dehydrogenase 3 family, member B2
• Alias Symbols: ALDH8
• NCBI Gene Id: 222
• Protein Name: Aldehyde dehydrogenase family 3 member B2
• Description of Target: This gene encodes a member of the aldehyde dehydrogenase family, a group of isozymes that may play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. The gene of this particular family member is over 10 kb in length. The expression of these transcripts is restricted to the salivary gland among the human tissues examined. Alternate transcriptional splice variants have been characterized.
• Uniprot ID: P48448
• Protein Accession #: NP_000686
• Nucleotide Accession #: NM_000695
• Protein Size (# AA): 385
• Molecular Weight: 42kDa
• Protein Interactions: UBC;