Loading...
Catalog No: ARP58417_P050
Price: $0.00
SKU
ARP58417_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ALDH1B1 (ARP58417_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ALDH1B1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 93%; Guinea Pig: 85%; Horse: 79%; Human: 100%; Mouse: 86%; Pig: 86%; Rat: 91%; Zebrafish: 85%
Peptide SequenceSynthetic peptide located within the following region: GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL
Concentration0.5 mg/ml
Blocking PeptideFor anti-ALDH1B1 (ARP58417_P050) antibody is Catalog # AAP58417 (Previous Catalog # AAPP34845)
Sample Type Confirmation

ALDH1B1 is supported by BioGPS gene expression data to be expressed in HeLa

ReferenceLuo,P., (2007) Stem Cells 25 (10), 2628-2637
Gene SymbolALDH1B1
Gene Full NameAldehyde dehydrogenase 1 family, member B1
Alias SymbolsALDH5, ALDHX
NCBI Gene Id219
Protein NameAldehyde dehydrogenase X, mitochondrial
Description of TargetALDH1B1 belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.
Uniprot IDP30837
Protein Accession #NP_000683
Nucleotide Accession #NM_000692
Protein Size (# AA)517
Molecular Weight57kDa
Protein InteractionsUBC; TATDN1; OGFOD1; UBR7; PDCD10; HEXB; FH; EXOSC10; XRN2; FN1; FABP2; ECT2; UQCRB; FBXO6; CUL3; MYC;
  1. What is the species homology for "ALDH1B1 Antibody - middle region (ARP58417_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Zebrafish".

  2. How long will it take to receive "ALDH1B1 Antibody - middle region (ARP58417_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ALDH1B1 Antibody - middle region (ARP58417_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ALDH1B1 Antibody - middle region (ARP58417_P050)"?

    This target may also be called "ALDH5, ALDHX" in publications.

  5. What is the shipping cost for "ALDH1B1 Antibody - middle region (ARP58417_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ALDH1B1 Antibody - middle region (ARP58417_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ALDH1B1 Antibody - middle region (ARP58417_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "57kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ALDH1B1 Antibody - middle region (ARP58417_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ALDH1B1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ALDH1B1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ALDH1B1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ALDH1B1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ALDH1B1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ALDH1B1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ALDH1B1 Antibody - middle region (ARP58417_P050)
Your Rating