Search Antibody, Protein, and ELISA Kit Solutions

ALDH1A3 Antibody - middle region (ARP78297_P050)

100 ul
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
aldehyde dehydrogenase 1 family member A3
NCBI Gene Id:
Protein Name:
aldehyde dehydrogenase family 1 member A3
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-166362 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes an aldehyde dehydrogenase enzyme that uses retinal as a substrate. Mutations in this gene have been associated with microphthalmia, isolated 8, and expression changes have also been detected in tumor cells. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
Molecular Weight:
56 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ALDH1A3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ALDH1A3.
The immunogen is a synthetic peptide directed towards the middle region of human ALDH1A3
Peptide Sequence:
Synthetic peptide located within the following region: RSVEYAKKRPVGDPFDVKTEQGPQIDQKQFDKILELIESGKKEGAKLECG
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ALDH1A3 (ARP78297_P050) antibody is Catalog # AAP78297
Printable datasheet for anti-ALDH1A3 (ARP78297_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...