Search Antibody, Protein, and ELISA Kit Solutions

ALDH1A3 Antibody - middle region (ARP78297_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
ALDH1A3
Official Gene Full Name:
aldehyde dehydrogenase 1 family member A3
NCBI Gene Id:
220
Protein Name:
aldehyde dehydrogenase family 1 member A3
Swissprot Id:
P47895
Protein Accession #:
NP_000684.2
Nucleotide Accession #:
NM_000693.3
Alias Symbols:
ALDH6, MCOP8, RALDH3, ALDH1A6,
Replacement Item:
This antibody may replace item sc-166362 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes an aldehyde dehydrogenase enzyme that uses retinal as a substrate. Mutations in this gene have been associated with microphthalmia, isolated 8, and expression changes have also been detected in tumor cells. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
512
Molecular Weight:
56 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ALDH1A3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ALDH1A3.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human ALDH1A3
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: RSVEYAKKRPVGDPFDVKTEQGPQIDQKQFDKILELIESGKKEGAKLECG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ALDH1A3 (ARP78297_P050) antibody is Catalog # AAP78297
Datasheets/Manuals:
Printable datasheet for anti-ALDH1A3 (ARP78297_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...