ALDH1A1 Recombinant Protein (Mouse) (OPCA03272)

Catalog No: OPCA03272

Aldh1a1 Recombinant Protein (Mouse) (OPCA03272) in SDS-PAGE showing the molecular weight of approximately 56.34 kDa.

Product Info

• Predicted Species Reactivity: Mouse|Mus musculus
• Product Format: Lyophilized 20mM Tris-HCl, 0.5M NaCl, 6% Trehalose
• Host: Mouse
• Reconstitution and Storage: Please reconstitute protein in deionized water to a concentration of 0.1-1.0 mg/ml. We recommend to add 5-50% glycerol. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Purification: Affinity purified using IMAC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: Full Length of Mature Protein: SSPAQPAVPAPLADLKIQHTKIFINNEWHNSVSGKKFPVLNPATEEVICHVEEGDKADVDKAVKAARQAFQIGSPWRTMDASERGRLLNKLADLMERDRLLLATMEALNGGKVFANAYLSDLGGCIKALKYCAGWADKIHGQTIPSDGDIFTYTRREPIGVCGQIIPWNFPMLMFIWKIGPALSCGNTVVVKPAEQTPLTALHLASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVDKVAFTGSTQVGKLIKEAAGKSNLKRVTLELGGKSPCIVFADADLDIAVEFAHHGVFYHQGQCCVAASRIFVEESVYDEFVKRSVERAKKYVLGNPLTPGINQGPQIDKEQHDKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSVDDVIKRANNTTYGLAAGLFTKDLDKAITVSSALQAGVVWVNCYMMLSAQCPFGGFKMSGNGRELGEHGLYEYTELKTVAMKISQKNS
• Source: Yeast
• Protein Range: 2-501 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Isolation and characterization of a cytosolic aldehyde dehydrogenase-encoding cDNA from mouse liver.Rongnoparut P., Weaver S.Gene 101:261-265(1991)
• Gene Symbol: Aldh1a1
• Gene Full Name: aldehyde dehydrogenase family 1, subfamily A1
• Alias Symbols: Ahd;Ahd-;Ahd2;Ahd-2;alcohol dehydrogenase family 1, subfamily A1;alcohol dehydrogenase family 1, subfamily A2;ALD;aldehyde dehydrogenase 1, liver cytosolic (class 1);aldehyde dehydrogenase family 1 member A1;aldehyde dehydrogenase, cytosolic;Aldh1;Aldh1a2;ALDH-E1;ALHDII;E1;Ral;RALDH 1;Raldh1;retinal dehydrogenase 1.
• NCBI Gene Id: 11668
• Protein Name: Retinal dehydrogenase 1
• Description of Target: Can convert/oxidize retinaldehyde to retinoic acid. Binds free retinal and cellular retinol-binding protein-bound retinal (By similarity). May have a broader specificity and oxidize other aldehydes in vivo (By similarity).
• Uniprot ID: P24549
• Protein Accession #: NP_038495.2
  
• Nucleotide Accession #: NM_013467.3
• Protein Size (# AA): Recombinant
• Molecular Weight: 56.3 kDa