ALBA Recombinant Protein (Pyrococcus furiosus) (OPCA03406)

Catalog No: OPCA03406

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

albA Recombinant Protein (Pyrococcus furiosus) (OPCA03406) in SDS-PAGE showing the molecular weight of approximately 26.38 kDa.

Product Info

• Predicted Species Reactivity: Pyrococcus furiosus
• Product Format: Liquid or Lyophilized powder
• Host: Pyrococcus furiosus
• Reconstitution and Storage: -20°C or -80°C
• Purification: Affinity purified using IMAC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: MAEEHVVYIGKKPVMNYVLAVITQFNEGAKEVSIKARGRAISRAVDVAEIVRNRFLKDTVDIKEIKIGTEELPTADGRTTNTSTIEIVLERKV
• Protein Sequence: Full Length: MAEEHVVYIGKKPVMNYVLAVITQFNEGAKEVSIKARGRAISRAVDVAEIVRNRFLKDTVDIKEIKIGTEELPTADGRTTNTSTIEIVLERKV
• Source: E.coli
• Protein Range: 1-93 aa
• Tag: N-terminal 6xHis-SUMO-tagged

Target Info

• Reference: Divergence of the hyperthermophilic archaea Pyrococcus furiosus and P. horikoshii inferred from complete genomic sequences.Maeder D.L., Weiss R.B., Dunn D.M., Cherry J.L., Gonzalez J.M., DiRuggiero J., Robb F.T.Genetics 152:1299-1305(1999)
• Gene Symbol: albA
• Gene Full Name: DNA-binding protein Alba
• Alias Symbols: DNA-binding protein Alba;PF_RS09500;PF1881.
• NCBI Gene Id: 1469760
• Protein Name: DNA/RNA-binding protein Alba
• Description of Target: Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.
• Uniprot ID: Q8TZV1
• Protein Accession #: WP_011013020.1
  
• Nucleotide Accession #: NC_003413.1
• Protein Size (# AA): Recombinant
• Molecular Weight: 26.4 kDa