Search Antibody, Protein, and ELISA Kit Solutions

ALB Antibody - N-terminal region (ARP41745_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41745_P050-FITC Conjugated

ARP41745_P050-HRP Conjugated

ARP41745_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
NCBI Gene Id:
Protein Name:
Serum albumin
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
DKFZp779N1935, PRO0883, PRO0903, PRO1341
Replacement Item:
This antibody may replace item sc-271604 from Santa Cruz Biotechnology.
Description of Target:
Albumin is a soluble, monomeric protein which comprises about one-half of the blood serum protein. Albumin functions primarily as a carrier protein for steroids, fatty acids, and thyroid hormones and plays a role in stabilizing extracellular fluid volume. Albumin is a globular unglycosylated serum protein of molecular weight 65,000. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that is removed before the nascent protein is released from the rough endoplasmic reticulum. The product, proalbumin, is in turn cleaved in the Golgi vesicles to produce the secreted albumin. Albumin is a soluble, monomeric protein which comprises about one-half of the blood serum protein. Albumin functions primarily as a carrier protein for steroids, fatty acids, and thyroid hormones and plays a role in stabilizing extracellular fluid volume. Albumin is a globular unglycosylated serum protein of molecular weight 65,000. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that is removed before the nascent protein is released from the rough endoplasmic reticulum. The product, proalbumin, is in turn cleaved in the Golgi vesicles to produce the secreted albumin. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ALB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ALB.
The immunogen is a synthetic peptide directed towards the N terminal region of human ALB
Predicted Species Reactivity:
Guinea Pig, Horse, Human, Mouse, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Guinea Pig: 100%; Horse: 82%; Human: 100%; Mouse: 90%; Rat: 100%
Complete computational species homology data:
Anti-ALB (ARP41745_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEET
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ALB (ARP41745_P050) antibody is Catalog # AAP41745 (Previous Catalog # AAPP24387)
Printable datasheet for anti-ALB (ARP41745_P050) antibody
Additional Information:
IHC Information: Paraffin embedded kidney tissue, tested with an antibody dilution of 5 ug/ml.
Target Reference:
Amirtharaj,G.J., (2008) Biochim. Biophys. Acta 1782 (5), 349-354

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...