Size:100 ul
$319.00
In Stock
SKU
ARP41746_P050-Biotin
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41746_P050 Unconjugated

ARP41746_P050-FITC Conjugated

ARP41746_P050-HRP Conjugated

ALB Antibody - middle region : Biotin (ARP41746_P050-Biotin)

Catalog#: ARP41746_P050-Biotin
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species Reactivity Cow, Dog, Goat, Horse, Human, Mouse, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation Biotin
Application IHC, WB
Additional Information IHC Information: Paraffin embedded kidney tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-271604 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ALB
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Goat: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Rat: 83%; Sheep: 86%
Complete computational species homology data Anti-ALB (ARP41746_P050)
Peptide Sequence Synthetic peptide located within the following region: LSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKE
Concentration 0.5 mg/ml
Blocking Peptide For anti-ALB (ARP41746_P050-Biotin) antibody is Catalog # AAP41746 (Previous Catalog # AAPP24388)
Datasheets/Manuals Printable datasheet for anti-ALB (ARP41746_P050-Biotin) antibody
Target Reference Amirtharaj,G.J., (2008) Biochim. Biophys. Acta 1782 (5), 349-354
Publications

Holzer, M. et al. Uremia alters HDL composition and function. J. Am. Soc. Nephrol. 22, 1631-41 (2011). WB, IHC, Human, Horse, Bovine, Goat, Dog, Mouse, Sheep, Rat 21804091

Gene Symbol ALB
Official Gene Full Name Albumin
Alias Symbols DKFZp779N1935, PRO0883, PRO0903, PRO1341
NCBI Gene Id 213
Protein Name Serum albumin
Description of Target Albumin is a soluble, monomeric protein which comprises about one-half of the blood serum protein. Albumin functions primarily as a carrier protein for steroids, fatty acids, and thyroid hormones and plays a role in stabilizing extracellular fluid volume. Albumin is a globular unglycosylated serum protein of molecular weight 65,000. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that is removed before the nascent protein is released from the rough endoplasmic reticulum. The product, proalbumin, is in turn cleaved in the Golgi vesicles to produce the secreted albumin.Albumin is a soluble, monomeric protein which comprises about one-half of the blood serum protein. Albumin functions primarily as a carrier protein for steroids, fatty acids, and thyroid hormones and plays a role in stabilizing extracellular fluid volume. Albumin is a globular unglycosylated serum protein of molecular weight 65,000. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that is removed before the nascent protein is released from the rough endoplasmic reticulum. The product, proalbumin, is in turn cleaved in the Golgi vesicles to produce the secreted albumin. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P02768
Protein Accession # NP_000468
Nucleotide Accession # NM_000477
Protein Size (# AA) 609
Molecular Weight 67kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ALB.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ALB.
Protein Interactions FUS; UBC; PARK2; UBD; PAN2; MYLK3; CABLES1; SLA2; TLN2; CEP44; PHC3; PALB2; QTRTD1; TTPAL; DERL1; CDCP1; TRAPPC11; SCAF1; NLRC4; IGDCC4; GJC2; CROT; EXOC6; PDZRN4; EEF2K; IGKV2-40; BBC3; LAT; SACS; SPATA31A7; AP4E1; CRB1; DICER1; OBSL1; SLC9A8; CAMTA1; SE
  1. What is the species homology for "ALB Antibody - middle region : Biotin (ARP41746_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Goat, Horse, Human, Mouse, Rat, Sheep".

  2. How long will it take to receive "ALB Antibody - middle region : Biotin (ARP41746_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ALB Antibody - middle region : Biotin (ARP41746_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ALB Antibody - middle region : Biotin (ARP41746_P050-Biotin)"?

    This target may also be called "DKFZp779N1935, PRO0883, PRO0903, PRO1341" in publications.

  5. What is the shipping cost for "ALB Antibody - middle region : Biotin (ARP41746_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ALB Antibody - middle region : Biotin (ARP41746_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ALB Antibody - middle region : Biotin (ARP41746_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "67kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ALB Antibody - middle region : Biotin (ARP41746_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ALB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ALB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ALB"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ALB"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ALB"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ALB"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ALB Antibody - middle region : Biotin (ARP41746_P050-Biotin)
Your Rating
We found other products you might like!