Search Antibody, Protein, and ELISA Kit Solutions

ALB Antibody - middle region : Biotin (ARP41746_P050-Biotin)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41746_P050 Unconjugated

ARP41746_P050-FITC Conjugated

ARP41746_P050-HRP Conjugated

Predicted Species Reactivity:
Cow, Dog, Goat, Horse, Human, Mouse, Rat, Sheep
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality:
Polyclonal
Host:
Rabbit
Conjugation:
Biotin
Application:
IHC, WB
Additional Information:
IHC Information: Paraffin embedded kidney tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item:
This antibody may replace item sc-271604 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human ALB
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Goat: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Rat: 83%; Sheep: 86%
Complete computational species homology data:
Anti-ALB (ARP41746_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKE
Concentration:
0.5 mg/ml
Blocking Peptide:
For anti-ALB (ARP41746_P050-Biotin) antibody is Catalog # AAP41746 (Previous Catalog # AAPP24388)
Datasheets/Manuals:
Printable datasheet for anti-ALB (ARP41746_P050-Biotin) antibody
Target Reference:
Amirtharaj,G.J., (2008) Biochim. Biophys. Acta 1782 (5), 349-354
Publications:

Holzer, M. et al. Uremia alters HDL composition and function. J. Am. Soc. Nephrol. 22, 1631-41 (2011). WB, IHC, Human, Horse, Bovine, Goat, Dog, Mouse, Sheep, Rat 21804091

Gene Symbol:
ALB
Official Gene Full Name:
Albumin
Alias Symbols:
DKFZp779N1935, PRO0883, PRO0903, PRO1341
NCBI Gene Id:
213
Protein Name:
Serum albumin
Description of Target:
Albumin is a soluble, monomeric protein which comprises about one-half of the blood serum protein. Albumin functions primarily as a carrier protein for steroids, fatty acids, and thyroid hormones and plays a role in stabilizing extracellular fluid volume. Albumin is a globular unglycosylated serum protein of molecular weight 65,000. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that is removed before the nascent protein is released from the rough endoplasmic reticulum. The product, proalbumin, is in turn cleaved in the Golgi vesicles to produce the secreted albumin.Albumin is a soluble, monomeric protein which comprises about one-half of the blood serum protein. Albumin functions primarily as a carrier protein for steroids, fatty acids, and thyroid hormones and plays a role in stabilizing extracellular fluid volume. Albumin is a globular unglycosylated serum protein of molecular weight 65,000. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that is removed before the nascent protein is released from the rough endoplasmic reticulum. The product, proalbumin, is in turn cleaved in the Golgi vesicles to produce the secreted albumin. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id:
P02768
Protein Accession #:
NP_000468
Nucleotide Accession #:
NM_000477
Protein Size (# AA):
609
Molecular Weight:
67kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ALB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ALB.
Protein Interactions:
FUS; UBC; PARK2; UBD; PAN2; MYLK3; CABLES1; SLA2; TLN2; CEP44; PHC3; PALB2; QTRTD1; TTPAL; DERL1; CDCP1; TRAPPC11; SCAF1; NLRC4; IGDCC4; GJC2; CROT; EXOC6; PDZRN4; EEF2K; IGKV2-40; BBC3; LAT; SACS; SPATA31A7; AP4E1; CRB1; DICER1; OBSL1; SLC9A8; CAMTA1; SE

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...