SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP41746_P050
Price: $0.00
SKU
ARP41746_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ALB (ARP41746_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Horse, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Paraffin embedded kidney tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ALB
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 86%; Goat: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Rat: 83%; Sheep: 86%
Peptide SequenceSynthetic peptide located within the following region: LSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKE
Concentration0.5 mg/ml
Blocking PeptideFor anti-ALB (ARP41746_P050) antibody is Catalog # AAP41746 (Previous Catalog # AAPP24388)
ReferenceAmirtharaj,G.J., (2008) Biochim. Biophys. Acta 1782 (5), 349-354
Publications

Holzer, M. et al. Uremia alters HDL composition and function. J. Am. Soc. Nephrol. 22, 1631-41 (2011). 21804091

Description
Gene SymbolALB
Gene Full NameAlbumin
Alias SymbolsHSA, PRO0883, PRO0903, PRO1341
NCBI Gene Id213
Protein NameSerum albumin
Description of TargetAlbumin is a soluble, monomeric protein which comprises about one-half of the blood serum protein. Albumin functions primarily as a carrier protein for steroids, fatty acids, and thyroid hormones and plays a role in stabilizing extracellular fluid volume. Albumin is a globular unglycosylated serum protein of molecular weight 65,000. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that is removed before the nascent protein is released from the rough endoplasmic reticulum. The product, proalbumin, is in turn cleaved in the Golgi vesicles to produce the secreted albumin.Albumin is a soluble, monomeric protein which comprises about one-half of the blood serum protein. Albumin functions primarily as a carrier protein for steroids, fatty acids, and thyroid hormones and plays a role in stabilizing extracellular fluid volume. Albumin is a globular unglycosylated serum protein of molecular weight 65,000. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that is removed before the nascent protein is released from the rough endoplasmic reticulum. The product, proalbumin, is in turn cleaved in the Golgi vesicles to produce the secreted albumin. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP02768
Protein Accession #NP_000468
Nucleotide Accession #NM_000477
Protein Size (# AA)609
Molecular Weight67kDa
Protein InteractionsFUS; UBC; PARK2; UBD; PAN2; MYLK3; CABLES1; SLA2; TLN2; CEP44; PHC3; PALB2; QTRTD1; TTPAL; DERL1; CDCP1; TRAPPC11; SCAF1; NLRC4; IGDCC4; GJC2; CROT; EXOC6; PDZRN4; EEF2K; IGKV2-40; BBC3; LAT; SACS; SPATA31A7; AP4E1; CRB1; DICER1; OBSL1; SLC9A8; CAMTA1; SE
  1. What is the species homology for "ALB Antibody - middle region (ARP41746_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Horse, Sheep".

  2. How long will it take to receive "ALB Antibody - middle region (ARP41746_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ALB Antibody - middle region (ARP41746_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ALB Antibody - middle region (ARP41746_P050)"?

    This target may also be called "HSA, PRO0883, PRO0903, PRO1341" in publications.

  5. What is the shipping cost for "ALB Antibody - middle region (ARP41746_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ALB Antibody - middle region (ARP41746_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ALB Antibody - middle region (ARP41746_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "67kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ALB Antibody - middle region (ARP41746_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ALB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ALB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ALB"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ALB"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ALB"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ALB"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ALB Antibody - middle region (ARP41746_P050)
Your Rating
We found other products you might like!