Search Antibody, Protein, and ELISA Kit Solutions

ALAS1 Antibody - N-terminal region : FITC (ARP72388_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72388_P050 Unconjugated

ARP72388_P050-HRP Conjugated

ARP72388_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Protein Accession #:
Alias Symbols:
ALAS1, ALAS3, ALASH, OK/SW-cl.121,
Replacement Item:
This antibody may replace item sc-118326 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes the mitochondrial enzyme which is catalyzes the rate-limiting step in heme (iron-protoporphyrin) biosynthesis. The enzyme encoded by this gene is the housekeeping enzyme; a separate gene encodes a form of the enzyme that is specific for erythroid tissue. The level of the mature encoded protein is regulated by heme: high levels of heme down-regulate the mature enzyme in mitochondria while low heme levels up-regulate. A pseudogene of this gene is located on chromosome 12. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ALAS1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ALAS1.
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ALAS1
Predicted Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: RALSTAAVHYQQIKETPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
0.5 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ALAS1 (ARP72388_P050-FITC) antibody is Catalog # AAP72388
Printable datasheet for anti-ALAS1 (ARP72388_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...