Catalog No: ARP56199_P050
Price: $0.00
SKU
ARP56199_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

AKTIP Antibody - middle region (ARP56199_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-AKTIP (ARP56199_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human AKTIP
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%
Peptide SequenceSynthetic peptide located within the following region: NPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEKTVA
Concentration0.5 mg/ml
Blocking PeptideFor anti-AKTIP (ARP56199_P050) antibody is Catalog # AAP56199 (Previous Catalog # AAPP38119)
ReferenceEwing,R.M., Mol. Syst. Biol. 3, 89 (2007)
Gene SymbolAKTIP
Gene Full NameAKT interacting protein
Alias SymbolsFT1, FTS
NCBI Gene Id64400
Protein NameAKT-interacting protein
Description of TargetAKTIP is the component of the FTS/Hook/FHIP complex (FHF complex). The FHF complex may function to promote vesicle trafficking and/or fusion via the homotypic vesicular protein sorting complex (the HOPS complex). AKTIP regulates apoptosis by enhancing phosphorylation and activation of AKT1. AKTIP increases release of TNFSF6 via the AKT1/GSK3B/NFATC1 signaling cascade.The mouse homolog of this gene produces fused toes and thymic hyperplasia in heterozygous mutant animals while homozygous mutants die in early development. This gene may play a role in apoptosis as these morphological abnormalities are caused by altered patterns of programmed cell death. The protein encoded by this gene is similar to the ubiquitin ligase domain of other ubiquitin-conjugating enzymes but lacks the conserved cysteine residue that enables those enzymes to conjugate ubiquitin to the target protein. This protein interacts directly with serine/threonine kinase protein kinase B (PKB)/Akt and modulates PKB activity by enhancing the phosphorylation of PKB's regulatory sites. Alternative splicing results in two transcript variants encoding the same protein.
Uniprot IDQ9H8T0
Protein Accession #NP_001012398
Nucleotide Accession #NM_001012398
Protein Size (# AA)292
Molecular Weight33kDa
Protein InteractionsHOOK1; HOOK2; HOOK3; FAM160A2; VPS16; VPS18; VPS41; TRIM23; TRIM41; MARCH5; DZIP3; KIAA1377; EXOC7; POLA2; GTF3C1; UTP14A; C10orf2; PDPK1; ASS1; CTBP2; IMMT; RPA1; AKT1; TIMM50; PDS5A; IARS; HDLBP; DCTN1;
  1. What is the species homology for "AKTIP Antibody - middle region (ARP56199_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "AKTIP Antibody - middle region (ARP56199_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "AKTIP Antibody - middle region (ARP56199_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "AKTIP Antibody - middle region (ARP56199_P050)"?

    This target may also be called "FT1, FTS" in publications.

  5. What is the shipping cost for "AKTIP Antibody - middle region (ARP56199_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "AKTIP Antibody - middle region (ARP56199_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "AKTIP Antibody - middle region (ARP56199_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "33kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "AKTIP Antibody - middle region (ARP56199_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "AKTIP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "AKTIP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "AKTIP"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "AKTIP"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "AKTIP"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "AKTIP"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:AKTIP Antibody - middle region (ARP56199_P050)
Your Rating
We found other products you might like!