AKTIP Antibody - middle region (ARP56199_P050)

Catalog No: ARP56199_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-AKTIP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Muscle

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AKTIP
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%
• Peptide Sequence: Synthetic peptide located within the following region: NPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEKTVA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-AKTIP (ARP56199_P050) antibody is Catalog # AAP56199 (Previous Catalog # AAPP38119)
• Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Target Info

• Gene Symbol: AKTIP
• Gene Full Name: AKT interacting protein
• Alias Symbols: FT1, FTS
• NCBI Gene Id: 64400
• Protein Name: AKT-interacting protein
• Description of Target: AKTIP is the component of the FTS/Hook/FHIP complex (FHF complex). The FHF complex may function to promote vesicle trafficking and/or fusion via the homotypic vesicular protein sorting complex (the HOPS complex). AKTIP regulates apoptosis by enhancing phosphorylation and activation of AKT1. AKTIP increases release of TNFSF6 via the AKT1/GSK3B/NFATC1 signaling cascade.The mouse homolog of this gene produces fused toes and thymic hyperplasia in heterozygous mutant animals while homozygous mutants die in early development. This gene may play a role in apoptosis as these morphological abnormalities are caused by altered patterns of programmed cell death. The protein encoded by this gene is similar to the ubiquitin ligase domain of other ubiquitin-conjugating enzymes but lacks the conserved cysteine residue that enables those enzymes to conjugate ubiquitin to the target protein. This protein interacts directly with serine/threonine kinase protein kinase B (PKB)/Akt and modulates PKB activity by enhancing the phosphorylation of PKB's regulatory sites. Alternative splicing results in two transcript variants encoding the same protein.
• Uniprot ID: Q9H8T0
• Protein Accession #: NP_001012398
• Nucleotide Accession #: NM_001012398
• Protein Size (# AA): 292
• Molecular Weight: 33kDa
• Protein Interactions: HOOK1; HOOK2; HOOK3; FAM160A2; VPS16; VPS18; VPS41; TRIM23; TRIM41; MARCH5; DZIP3; KIAA1377; EXOC7; POLA2; GTF3C1; UTP14A; C10orf2; PDPK1; ASS1; CTBP2; IMMT; RPA1; AKT1; TIMM50; PDS5A; IARS; HDLBP; DCTN1;