Catalog No: AVARP02063_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-AKT2 (AVARP02063_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human AKT2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: NTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPM
Concentration0.5 mg/ml
Blocking PeptideFor anti-AKT2 (AVARP02063_P050) antibody is Catalog # AAP30467 (Previous Catalog # AAPP01103)
Sample Type Confirmation

There is BioGPS gene expression data showing that AKT2 is expressed in OVCAR3

ReferenceTan,Y., (2008) Cancer Res. 68 (5), 1296-1302
Gene SymbolAKT2
Gene Full NameV-akt murine thymoma viral oncogene homolog 2
NCBI Gene Id208
Protein NameRAC-beta serine/threonine-protein kinase
Description of TargetAKT2 belonging to a subfamily of serine/threonine kinases containing SH2-like (Src homology 2-like) domains. The gene encoding AKT2 was shown to be amplified and overexpressed in 2 of 8 ovarian carcinoma cell lines and 2 of 15 primary ovarian tumors. Over
Uniprot IDP31751
Protein Accession #NP_001617
Nucleotide Accession #NM_001626
Protein Size (# AA)481
Molecular Weight56kDa
  1. What is the species homology for "AKT2 Antibody - N-terminal region (AVARP02063_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig".

  2. How long will it take to receive "AKT2 Antibody - N-terminal region (AVARP02063_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "AKT2 Antibody - N-terminal region (AVARP02063_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "AKT2 Antibody - N-terminal region (AVARP02063_P050)"?

    This target may also be called "PKBB, PRKBB, HIHGHH, PKBBETA, RAC-BETA" in publications.

  5. What is the shipping cost for "AKT2 Antibody - N-terminal region (AVARP02063_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "AKT2 Antibody - N-terminal region (AVARP02063_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "AKT2 Antibody - N-terminal region (AVARP02063_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "56kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "AKT2 Antibody - N-terminal region (AVARP02063_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "AKT2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "AKT2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "AKT2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "AKT2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "AKT2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "AKT2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:AKT2 Antibody - N-terminal region (AVARP02063_P050)
Your Rating
We found other products you might like!