Search Antibody, Protein, and ELISA Kit Solutions

AKT2 Antibody - middle region (ARP87354_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
AKT2
Official Gene Full Name:
v-akt murine thymoma viral oncogene homolog 2
NCBI Gene Id:
208
Protein Name:
RAC-beta serine/threonine-protein kinase
Swissprot Id:
P31751-2
Protein Accession #:
NP_001617.1
Nucleotide Accession #:
NM_001626.5
Alias Symbols:
PKBB, PRKBB, HIHGHH, PKBBETA, RAC-BETA
Description of Target:
This gene is a putative oncogene encoding a protein belonging to a subfamily of serine/threonine kinases containing SH2-like (Src homology 2-like) domains. The gene was shown to be amplified and overexpressed in 2 of 8 ovarian carcinoma cell lines and 2 of 15 primary ovarian tumors. Overexpression contributes to the malignant phenotype of a subset of human ductal pancreatic cancers. The encoded protein is a general protein kinase capable of phophorylating several known proteins.
Protein Size (# AA):
438
Molecular Weight:
48 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express AKT2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express AKT2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human AKT2
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: NQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-AKT2 (ARP87354_P050) antibody is Catalog # AAP87354
Datasheets/Manuals:
Printable datasheet for anti-AKT2 (ARP87354_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...