AKT1 Antibody - N-terminal region : HRP (AVARP06008_P050-HRP)

Catalog No: AVARP06008_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Pig, Sheep
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AKT1
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 100%; Goat: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100%; Sheep: 86%
• Peptide Sequence: Synthetic peptide located within the following region: RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-AKT1 (AVARP06008_P050-HRP) antibody is Catalog # AAP30466
• Reference: Kim,H.A., et al., (2006) Exp. Mol. Pathol. 80 (2), 165-170

Target Info

• Gene Symbol: AKT1
• Gene Full Name: V-akt murine thymoma viral oncogene homolog 1
• Alias Symbols: AKT, PKB, RAC, PRKBA, PKB-ALPHA, RAC-ALPHA
• NCBI Gene Id: 207
• Protein Name: RAC-alpha serine/threonine-protein kinase
• Description of Target: AKT1 is a general protein kinase capable of phosphorylating several known proteins.The serine-threonine protein kinase encoded by the AKT1 gene is catalytically inactive in serum-starved primary and immortalized fibroblasts. AKT1 and the related AKT2 are activated by platelet-derived growth factor. The activation is rapid and specific, and it is abrogated by mutations in the pleckstrin homology domain of AKT1. It was shown that the activation occurs through phosphatidylinositol 3-kinase. In the developing nervous system AKT is a critical mediator of growth factor-induced neuronal survival. Survival factors can suppress apoptosis in a transcription-independent manner by activating the serine/threonine kinase AKT1, which then phosphorylates and inactivates components of the apoptotic machinery. Multiple alternatively spliced transcript variants have been found for this gene.
• Uniprot ID: P31749
• Protein Accession #: NP_005154
• Nucleotide Accession #: NM_005163
• Protein Size (# AA): 480
• Molecular Weight: 56kDa