AKR7A3 Antibody - middle region : HRP (ARP54824_P050-HRP)

Catalog No: ARP54824_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AKR7A3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rat: 86%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: VETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTW
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-AKR7A3 (ARP54824_P050-HRP) antibody is Catalog # AAP54824 (Previous Catalog # AAPP31628)

Target Info

• Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321
• Gene Symbol: AKR7A3
• Gene Full Name: Aldo-keto reductase family 7, member A3 (aflatoxin aldehyde reductase)
• Alias Symbols: AFAR2
• NCBI Gene Id: 22977
• Protein Name: Aflatoxin B1 aldehyde reductase member 3
• Description of Target: Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones.Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-291 BM855386.1 13-303 292-719 BM920315.1 256-683 720-1015 BC031562.1 662-957 1016-1231 BG747063.1 249-464 1232-1241 AA844782.1 59-68 c 1242-1301 BC042420.1 1208-1267
• Uniprot ID: O95154
• Protein Accession #: NP_036199
• Nucleotide Accession #: NM_012067
• Protein Size (# AA): 331
• Molecular Weight: 37kDa
• Protein Interactions: AKR7A3; BAG3; TERF2IP; AKR7A2;