Catalog No: ARP54824_P050
Price: $0.00
SKU
ARP54824_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

AKR7A3 Antibody - middle region (ARP54824_P050)

Datasheets/ManualsPrintable datasheet for anti-AKR7A3 (ARP54824_P050) antibody
Product Info
ReferenceGregory,S.G., (2006) Nature 441 (7091), 315-321
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human AKR7A3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rat: 86%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: VETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTW
Concentration0.5 mg/ml
Blocking PeptideFor anti-AKR7A3 (ARP54824_P050) antibody is Catalog # AAP54824 (Previous Catalog # AAPP31628)
Gene SymbolAKR7A3
Gene Full NameAldo-keto reductase family 7, member A3 (aflatoxin aldehyde reductase)
Alias SymbolsAFAR2
NCBI Gene Id22977
Protein NameAflatoxin B1 aldehyde reductase member 3
Description of TargetAldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones.Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-291 BM855386.1 13-303 292-719 BM920315.1 256-683 720-1015 BC031562.1 662-957 1016-1231 BG747063.1 249-464 1232-1241 AA844782.1 59-68 c 1242-1301 BC042420.1 1208-1267
Uniprot IDO95154
Protein Accession #NP_036199
Nucleotide Accession #NM_012067
Protein Size (# AA)331
Molecular Weight37kDa
Protein InteractionsAKR7A3; BAG3; TERF2IP; AKR7A2;
  1. What is the species homology for "AKR7A3 Antibody - middle region (ARP54824_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish".

  2. How long will it take to receive "AKR7A3 Antibody - middle region (ARP54824_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "AKR7A3 Antibody - middle region (ARP54824_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "AKR7A3 Antibody - middle region (ARP54824_P050)"?

    This target may also be called "AFAR2" in publications.

  5. What is the shipping cost for "AKR7A3 Antibody - middle region (ARP54824_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "AKR7A3 Antibody - middle region (ARP54824_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "AKR7A3 Antibody - middle region (ARP54824_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "37kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "AKR7A3 Antibody - middle region (ARP54824_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "AKR7A3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "AKR7A3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "AKR7A3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "AKR7A3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "AKR7A3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "AKR7A3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:AKR7A3 Antibody - middle region (ARP54824_P050)
Your Rating
We found other products you might like!