Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP65054_P050
Price: $0.00
SKU
ARP65054_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-AKR7A2 (ARP65054_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 79%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 79%; Rat: 100%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: SETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-AKR7A2 (ARP65054_P050) antibody is Catalog # AAP65054
Gene SymbolAKR7A2
Gene Full NameAldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase)
Alias SymbolsAFAR, AKR7, AFAR1, AFB1-AR1
NCBI Gene Id8574
Protein NameAflatoxin B1 aldehyde reductase member 2
Description of TargetThe protein encoded by this gene belongs to the aldo/keto reductase (AKR) superfamily and AKR7 family, which are involved in the detoxification of aldehydes and ketones. The AKR7 family consists of 3 genes that are present in a cluster on the p arm of chromosome 1. This protein, thought to be localized in the golgi, catalyzes the NADPH-dependent reduction of succinic semialdehyde to the endogenous neuromodulator, gamma-hydroxybutyrate. It may also function as a detoxication enzyme in the reduction of aflatoxin B1 and 2-carboxybenzaldehyde.
Uniprot IDO43488
Protein Accession #NP_003680
Nucleotide Accession #NM_003689
Protein Size (# AA)359
Molecular Weight39kDa
Protein InteractionsAKR7A2; UBC; ITGA4; FN1; TRIM63; AKR7A3; F2;
  1. What is the species homology for "AKR7A2 Antibody - N-terminal region (ARP65054_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "AKR7A2 Antibody - N-terminal region (ARP65054_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "AKR7A2 Antibody - N-terminal region (ARP65054_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "AKR7A2 Antibody - N-terminal region (ARP65054_P050)"?

    This target may also be called "AFAR, AKR7, AFAR1, AFB1-AR1" in publications.

  5. What is the shipping cost for "AKR7A2 Antibody - N-terminal region (ARP65054_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "AKR7A2 Antibody - N-terminal region (ARP65054_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "AKR7A2 Antibody - N-terminal region (ARP65054_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "39kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "AKR7A2 Antibody - N-terminal region (ARP65054_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "AKR7A2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "AKR7A2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "AKR7A2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "AKR7A2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "AKR7A2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "AKR7A2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:AKR7A2 Antibody - N-terminal region (ARP65054_P050)
Your Rating