SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP42553_T100
Price: $0.00
SKU
ARP42553_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-AKR1B10 (ARP42553_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human AKR1B10
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%; Yeast: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: NEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDL
Concentration1.0 mg/ml
Blocking PeptideFor anti-AKR1B10 (ARP42553_T100) antibody is Catalog # AAP42553 (Previous Catalog # AAPP11040)
Sample Type Confirmation

AKR1B10 is supported by BioGPS gene expression data to be expressed in A549

ReferenceLee,Y.S., (2005) Int. J. Biochem. Cell Biol. 37 (11), 2297-2309
Gene SymbolAKR1B10
Gene Full NameAldo-keto reductase family 1, member B10 (aldose reductase)
Alias SymbolsHIS, HSI, ARL1, ARL-1, ALDRLn, AKR1B11, AKR1B12
NCBI Gene Id57016
Protein NameAldo-keto reductase family 1 member B10
Description of TargetAKR1B10 is a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.
Uniprot IDO60218
Protein Accession #NP_064695
Nucleotide Accession #NM_020299
Protein Size (# AA)316
Molecular Weight35kDa
Protein InteractionsNOS2; TERF2IP; ACACA;
  1. What is the species homology for "AKR1B10 Antibody - N-terminal region (ARP42553_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish".

  2. How long will it take to receive "AKR1B10 Antibody - N-terminal region (ARP42553_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "AKR1B10 Antibody - N-terminal region (ARP42553_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "AKR1B10 Antibody - N-terminal region (ARP42553_T100)"?

    This target may also be called "HIS, HSI, ARL1, ARL-1, ALDRLn, AKR1B11, AKR1B12" in publications.

  5. What is the shipping cost for "AKR1B10 Antibody - N-terminal region (ARP42553_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "AKR1B10 Antibody - N-terminal region (ARP42553_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "AKR1B10 Antibody - N-terminal region (ARP42553_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "35kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "AKR1B10 Antibody - N-terminal region (ARP42553_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "AKR1B10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "AKR1B10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "AKR1B10"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "AKR1B10"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "AKR1B10"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "AKR1B10"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:AKR1B10 Antibody - N-terminal region (ARP42553_T100)
Your Rating
We found other products you might like!