Catalog No: ARP36795_P050
Price: $0.00
SKU
ARP36795_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-AKAP7 (ARP36795_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Cow, Guinea Pig, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human AKAP7
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 82%; Guinea Pig: 82%; Human: 91%; Pig: 91%; Rabbit: 91%
Peptide SequenceSynthetic peptide located within the following region: DERLAKAMVSDGSFHITLLVMQLLNEDEVNIGIDALLELKPFIEELLQGK
Concentration0.5 mg/ml
Blocking PeptideFor anti-AKAP7 (ARP36795_P050) antibody is Catalog # AAP36795 (Previous Catalog # AAPS06401)
ReferenceGold,M.G., (2008) J. Mol. Biol. 375 (5), 1329-1343
Gene SymbolAKAP7
Gene Full NameA kinase (PRKA) anchor protein 7
Alias SymbolsAKAP15, AKAP18
NCBI Gene Id9465
Protein NameA-kinase anchor protein 7 isoform gamma
Description of TargetAKAP7 is a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described. Additional variants exist, but their full-length natures have not been determined. This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described. Additional variants exist, but their full-length natures have not been determined.
Uniprot IDQ9P0M2
Protein Accession #NP_057461
Nucleotide Accession #NM_016377
Protein Size (# AA)326
Molecular Weight37kDa
Protein InteractionsCEP76; ROPN1; SPA17; PRKAR2B; PRKACB; PRKACA; MEPCE; USP4; PRKAR1A; PRKAR2A;
  1. What is the species homology for "AKAP7 Antibody - middle region (ARP36795_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Cow, Guinea Pig, Pig, Rabbit".

  2. How long will it take to receive "AKAP7 Antibody - middle region (ARP36795_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "AKAP7 Antibody - middle region (ARP36795_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "AKAP7 Antibody - middle region (ARP36795_P050)"?

    This target may also be called "AKAP15, AKAP18" in publications.

  5. What is the shipping cost for "AKAP7 Antibody - middle region (ARP36795_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "AKAP7 Antibody - middle region (ARP36795_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "AKAP7 Antibody - middle region (ARP36795_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "37kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "AKAP7 Antibody - middle region (ARP36795_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "AKAP7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "AKAP7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "AKAP7"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "AKAP7"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "AKAP7"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "AKAP7"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:AKAP7 Antibody - middle region (ARP36795_P050)
Your Rating
We found other products you might like!