AKAP10 Antibody - middle region (ARP36326_P050)

Catalog No: ARP36326_P050

WB Suggested Anti-AKAP10 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: RPMI 8226 cell lysate

Host: Rabbit
Target Name: AKAP10
Sample Type: 293T
Antibody Dilution: 1.0ug/mlAKAP10 is supported by BioGPS gene expression data to be expressed in HEK293T

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AKAP10
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 90%
• Peptide Sequence: Synthetic peptide located within the following region: ESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-AKAP10 (ARP36326_P050) antibody is Catalog # AAP36326 (Previous Catalog # AAPP07513)
• Sample Type Confirmation:

  AKAP10 is supported by BioGPS gene expression data to be expressed in HEK293T

Target Info

• Gene Symbol: AKAP10
• Gene Full Name: A kinase (PRKA) anchor protein 10
• Alias Symbols: PRKA10, AKAP-10, D-AKAP2, D-AKAP-2
• NCBI Gene Id: 11216
• Protein Name: A-kinase anchor protein 10, mitochondrial
• Description of Target: The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein interacts with both the type I and type II regulatory subunits of PKA; therefore, it is a dual-specific AKAP. This protein is highly enriched in mitochondria. It contains RGS (regulator of G protein signalling) domains, in addition to a PKA-RII subunit-binding domain. The mitochondrial localization and the presence of RGS domains may have important implications for the function of this protein in PKA and G protein signal transduction.
• Uniprot ID: O43572
• Protein Accession #: NP_009133
• Nucleotide Accession #: NM_007202
• Protein Size (# AA): 662
• Molecular Weight: 71kDa
• Protein Interactions: COG3; DCTN4; MYH9; PRKAR1A; HAX1; SLC9A3R1; PDZK1; PRKAR2B; PRKAR2A;