AK2 Antibody - middle region (ARP81397_P050)

Catalog No: ARP81397_P050

Host: Rabbit
Target Name: AK2
Sample Tissue: Human HepG2 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AK2
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: LIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-AK2 (ARP81397_P050) antibody is Catalog # AAP81397

Target Info

• Gene Symbol: AK2
• Gene Full Name: adenylate kinase 2
• Alias Symbols: ADK2
• NCBI Gene Id: 204
• Protein Name: adenylate kinase 2, mitochondrial
• Description of Target: Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Mutations in this gene are the cause of reticular dysgenesis. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 1 and 2.
• Uniprot ID: P54819-5
• Protein Accession #: NP_001186128.1
• Nucleotide Accession #: NM_001199199.1
• Protein Size (# AA): 224
• Molecular Weight: 24 kDa