AK2 Antibody - middle region (ARP46058_P050)

Catalog No: ARP46058_P050

WB Suggested Anti-AK2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: RPMI 8226 cell lysateAK2 is strongly supported by BioGPS gene expression data to be expressed in RPMI-8226

Host: Mouse
Target Name: AK2
Sample Tissue: Mouse Testis
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AK2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-AK2 (ARP46058_P050) antibody is Catalog # AAP46058 (Previous Catalog # AAPs17204)
• Sample Type Confirmation:

  AK2 is strongly supported by BioGPS gene expression data to be expressed in RPMI-8226

Target Info

• Gene Symbol: AK2
• Gene Full Name: Adenylate kinase 2
• Alias Symbols: ADK2
• NCBI Gene Id: 204
• Protein Name: Adenylate kinase 2, mitochondrial
• Description of Target: Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis.
• Uniprot ID: P54819
• Protein Accession #: NP_001616
• Nucleotide Accession #: NM_001625
• Protein Size (# AA): 239
• Molecular Weight: 26kDa
• Protein Interactions: HUWE1; UBC; MDM2; BAG3; ABCC5; ABCC6; TUFM; SAFB; MRPL12; IDH1; DSP; DLD; RAVER1; TELO2; CUL3; SHBG; SUMO2; MEPCE;