- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for AK1 Antibody (OAAL00010) |
|---|
| Predicted Species Reactivity | Human, Mouse |
|---|---|
| Product Format | Liquid |
| Clonality | Monoclonal |
| Clone | 3G8-1B11 |
| Isotype | IgG1 Kappa |
| Host | Mouse |
| Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot |
| Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
| Immunogen | AK1 (AAH01116, 1 a.a. ~ 194 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Peptide Sequence | MEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Symbol | AK1 |
|---|---|
| Gene Full Name | adenylate kinase 1 |
| Alias Symbols | adenylate kinase isoenzyme 1;adenylate monophosphate kinase;ATP:AMP phosphotransferase;ATP-AMP transphosphorylase 1;epididymis secretory sperm binding protein;HTL-S-58j;myokinase;testis secretory sperm binding protein Li 58j. |
| NCBI Gene Id | 203 |
| Protein Name | Adenylate kinase 1 [Homo sapiens]|Homo sapiens adenylate kinase 1, mRNA (cDNA clone MGC:1808 IMAGE:2988248), complete cds |
| Description of Target | Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme. [provided by RefSeq |
| Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/AAH01116 |
| Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/BC001116 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "AK1 Antibody (OAAL00010)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "AK1 Antibody (OAAL00010)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "AK1 Antibody (OAAL00010)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "AK1 Antibody (OAAL00010)"?
This target may also be called "adenylate kinase isoenzyme 1;adenylate monophosphate kinase;ATP:AMP phosphotransferase;ATP-AMP transphosphorylase 1;epididymis secretory sperm binding protein;HTL-S-58j;myokinase;testis secretory sperm binding protein Li 58j." in publications.
-
What is the shipping cost for "AK1 Antibody (OAAL00010)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "AK1 Antibody (OAAL00010)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "AK1 Antibody (OAAL00010)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "AK1 Antibody (OAAL00010)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "AK1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "AK1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "AK1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "AK1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "AK1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "AK1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
