Search Antibody, Protein, and ELISA Kit Solutions

Ak1 Antibody - middle region (ARP54830_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP54830_P050-FITC Conjugated

ARP54830_P050-HRP Conjugated

ARP54830_P050-Biotin Conjugated

Gene Symbol:
Ak1
NCBI Gene Id:
24183
Protein Name:
Adenylate kinase isoenzyme 1
Swissprot Id:
P39069
Protein Accession #:
NP_077325
Nucleotide Accession #:
NM_024349
Alias Symbols:
-
Replacement Item:
This antibody may replace item sc-165981 from Santa Cruz Biotechnology.
Description of Target:
Ak1 catalyzes the conversion of ATP and AMP to ADP in adenine nucleotide metabolism.
Protein Size (# AA):
194
Molecular Weight:
21kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Ak1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Ak1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Rat Ak1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Tested Species Reactivity:
Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 86%; Zebrafish: 100%
Peptide Sequence:
Synthetic peptide located within the following region: TVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFERKIAQPTLLLYVDA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Ak1 (ARP54830_P050) antibody is Catalog # AAP54830
Datasheets/Manuals:
Printable datasheet for anti-Ak1 (ARP54830_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...