Size:100 ul
$125.00
In Stock
SKU
ARP44947_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP44947_P050-FITC Conjugated

ARP44947_P050-HRP Conjugated

ARP44947_P050-Biotin Conjugated

AJAP1 Antibody (ARP44947_P050)

Catalog#: ARP44947_P050
Domestic: within 1 week delivery | International: 1 week
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the following sequence RGKRHLQGDGLSSFDSRGSRPTTETEFIAWGPTGDEEALESNTFPGVYGP
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 83%; Rat: 85%
Complete computational species homology data Anti-AJAP1 (ARP44947_P050)
Peptide Sequence Synthetic peptide located within the following region: RGKRHLQGDGLSSFDSRGSRPTTETEFIAWGPTGDEEALESNTFPGVYGP
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide Available upon request
Datasheets/Manuals Printable datasheet for anti-AJAP1 (ARP44947_P050) antibody
Publications

Endogenous AJAP1 associates with the cytoskeleton and attenuates angiogenesis in endothelial cells. Biol Open. 6, 723-731 (2017). Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat 28483980

Gene Symbol AJAP1
Official Gene Full Name adherens junctions associated protein 1
Alias Symbols MOT8, SHREW1, SHREW-1, RP3-426F10.1,
NCBI Gene Id 55966
Protein Name Adherens junction-associated protein 1
Swissprot Id Q9UKB5
Protein Accession # NP_001035943
Nucleotide Accession # NM_001042478
Protein Size (# AA) 411
Molecular Weight 45 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express AJAP1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express AJAP1.
Protein Interactions Dlg4; CTNNB1; CDH1;
  1. What is the species homology for "AJAP1 Antibody (ARP44947_P050)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat".

  2. How long will it take to receive "AJAP1 Antibody (ARP44947_P050)"?

    This item is available "Domestic: within 1 week delivery | International: 1 week".

  3. What buffer format is "AJAP1 Antibody (ARP44947_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "AJAP1 Antibody (ARP44947_P050)"?

    This target may also be called "MOT8, SHREW1, SHREW-1, RP3-426F10.1, " in publications.

  5. What is the shipping cost for "AJAP1 Antibody (ARP44947_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "AJAP1 Antibody (ARP44947_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "AJAP1 Antibody (ARP44947_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "45 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "AJAP1 Antibody (ARP44947_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "AJAP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "AJAP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "AJAP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "AJAP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "AJAP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "AJAP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:AJAP1 Antibody (ARP44947_P050)
Your Rating
We found other products you might like!