Size:100 ul
$125.00
In Stock
SKU
ARP44946_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP44946_P050-FITC Conjugated

ARP44946_P050-HRP Conjugated

ARP44946_P050-Biotin Conjugated

AJAP1 Antibody (ARP44946_P050)

Catalog#: ARP44946_P050
Domestic: within 1 week delivery | International: 1 week
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species ReactivityCow, Horse, Human, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the following sequence PPRLWSFRSGQPARVPAPVWSPRPPRVERIHGQMQMPRARRAHRPRDQAA
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Horse: 92%; Human: 100%; Rat: 75%
Complete computational species homology dataAnti-AJAP1 (ARP44946_P050)
Peptide SequenceSynthetic peptide located within the following region: PPRLWSFRSGQPARVPAPVWSPRPPRVERIHGQMQMPRARRAHRPRDQAA
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideAvailable upon request
Datasheets/ManualsPrintable datasheet for anti-AJAP1 (ARP44946_P050) antibody
Publications

Endogenous AJAP1 associates with the cytoskeleton and attenuates angiogenesis in endothelial cells. Biol Open. 6, 723-731 (2017). Cow, Horse, Human, Rat 28483980

Gene SymbolAJAP1
Official Gene Full Nameadherens junctions associated protein 1
Alias SymbolsMOT8, SHREW1, SHREW-1, RP3-426F10.1,
NCBI Gene Id55966
Protein NameAdherens junction-associated protein 1
Swissprot IdQ9UKB5
Protein Accession #NP_001035943
Nucleotide Accession #NM_001042478
Protein Size (# AA)411
Molecular Weight45 kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express AJAP1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express AJAP1.
Protein InteractionsDlg4; CTNNB1; CDH1;
Write Your Own Review
You're reviewing:AJAP1 Antibody (ARP44946_P050)
Your Rating
Aviva HIS tag Deal
Aviva Blast Tool
Assay Development
Aviva Live Chat