Search Antibody, Protein, and ELISA Kit Solutions

AJAP1 Antibody (ARP44946_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP44946_P050-FITC Conjugated

ARP44946_P050-HRP Conjugated

ARP44946_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Predicted Species Reactivity:
Cow, Horse, Human, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
The immunogen is a synthetic peptide directed towards the following sequence PPRLWSFRSGQPARVPAPVWSPRPPRVERIHGQMQMPRARRAHRPRDQAA
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Horse: 92%; Human: 100%; Rat: 75%
Complete computational species homology data:
Anti-AJAP1 (ARP44946_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PPRLWSFRSGQPARVPAPVWSPRPPRVERIHGQMQMPRARRAHRPRDQAA
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
Available upon request
Printable datasheet for anti-AJAP1 (ARP44946_P050) antibody

Endogenous AJAP1 associates with the cytoskeleton and attenuates angiogenesis in endothelial cells. Biol Open. 6, 723-731 (2017). Cow, Horse, Human, Rat 28483980

Gene Symbol:
Official Gene Full Name:
adherens junctions associated protein 1
Alias Symbols:
MOT8, SHREW1, SHREW-1, RP3-426F10.1,
NCBI Gene Id:
Protein Name:
Adherens junction-associated protein 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
45 kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express AJAP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express AJAP1.
Protein Interactions:
Dlg4; CTNNB1; CDH1;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...