Search Antibody, Protein, and ELISA Kit Solutions

AIPL1 Antibody - middle region (ARP87548_P050)

100 ul
In Stock
Request Bulk Order Quote

Gene Symbol:
Official Gene Full Name:
aryl hydrocarbon receptor interacting protein-like 1
NCBI Gene Id:
Protein Name:
aryl-hydrocarbon-interacting protein-like 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
Leber congenital amaurosis (LCA) is the most severe inherited retinopathy with the earliest age of onset and accounts for at least 5% of all inherited retinal diseases. Affected individuals are diagnosed at birth or in the first few months of life with nystagmus, severely impaired vision or blindness and an abnormal or flat electroretinogram. The photoreceptor/pineal-expressed gene, AIPL1, encoding aryl-hydrocarbon interacting protein-like 1, is located within the LCA4 candidate region. The encoded protein contains three tetratricopeptide motifs, consistent with chaperone or nuclear transport activity. Mutations in this gene may cause approximately 20% of recessive LCA. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
Molecular Weight:
42 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express AIPL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express AIPL1.
The immunogen is a synthetic peptide directed towards the middle region of human AIPL1
Predicted Species Reactivity:
Tested Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: WHVHTCGLANMFAYHTLGYEDLDELQKEPQPLVFVIELLQVDAPSDYQRE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-AIPL1 (ARP87548_P050) antibody is Catalog # AAP87548
Printable datasheet for anti-AIPL1 (ARP87548_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...