Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP37218_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP37218_P050-FITC Conjugated

ARP37218_P050-HRP Conjugated

ARP37218_P050-Biotin Conjugated

Aip Antibody - middle region (ARP37218_P050)

Catalog#: ARP37218_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data Anti-Aip (ARP37218_P050)
Peptide Sequence Synthetic peptide located within the following region: VAKSLRNIAEGKDPLEGQRHCCGIAQMHEHSSLGHADLDALQQNPQPLIF
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-Aip (ARP37218_P050) antibody is Catalog # AAP37218 (Previous Catalog # AAPP09421)
Datasheets/Manuals Printable datasheet for anti-Aip (ARP37218_P050) antibody
Gene Symbol Aip
Official Gene Full Name Aryl-hydrocarbon receptor-interacting protein
Alias Symbols AA408703, AW476050, Ara9, D19Bwg1412e, Fkbp16, Xap2
NCBI Gene Id 11632
Protein Name AH receptor-interacting protein
Description of Target Aip may play a positive role in AHR-mediated (aromatic hydrocarbon receptor) signaling, possibly by influencing its receptivity for ligand and/or its nuclear targeting.
Swissprot Id O08915
Protein Accession # NP_057875
Nucleotide Accession # NM_016666
Protein Size (# AA) 330
Molecular Weight 37kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Aip.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Aip.
Protein Interactions Ahr; Hsp90ab1;
  1. What is the species homology for "Aip Antibody - middle region (ARP37218_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish".

  2. How long will it take to receive "Aip Antibody - middle region (ARP37218_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Aip Antibody - middle region (ARP37218_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Aip Antibody - middle region (ARP37218_P050)"?

    This target may also be called "AA408703, AW476050, Ara9, D19Bwg1412e, Fkbp16, Xap2" in publications.

  5. What is the shipping cost for "Aip Antibody - middle region (ARP37218_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Aip Antibody - middle region (ARP37218_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Aip Antibody - middle region (ARP37218_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "37kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Aip Antibody - middle region (ARP37218_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "AIP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "AIP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "AIP"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "AIP"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "AIP"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "AIP"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Aip Antibody - middle region (ARP37218_P050)
Your Rating
We found other products you might like!