Aip Antibody - middle region (ARP37218_P050)

Catalog No: ARP37218_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-Aip Antibody Titration: 0.2-1 ug/ml
Positive Control: SP2/0 cell lysate

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Rat: 100%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: VAKSLRNIAEGKDPLEGQRHCCGIAQMHEHSSLGHADLDALQQNPQPLIF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Aip (ARP37218_P050) antibody is Catalog # AAP37218 (Previous Catalog # AAPP09421)

Target Info

• Gene Symbol: Aip
• Gene Full Name: Aryl-hydrocarbon receptor-interacting protein
• Alias Symbols: A, Xa, Ara9, Xap2, Fkbp1, Fkbp16, AA408703, AW476050, D19Bwg1412e
• NCBI Gene Id: 11632
• Protein Name: AH receptor-interacting protein
• Description of Target: Aip may play a positive role in AHR-mediated (aromatic hydrocarbon receptor) signaling, possibly by influencing its receptivity for ligand and/or its nuclear targeting.
• Uniprot ID: O08915
• Protein Accession #: NP_057875
• Nucleotide Accession #: NM_016666
• Protein Size (# AA): 330
• Molecular Weight: 37kDa
• Protein Interactions: Ahr; Hsp90ab1;