Search Antibody, Protein, and ELISA Kit Solutions

Aip Antibody - middle region (ARP37218_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP37218_P050-FITC Conjugated

ARP37218_P050-HRP Conjugated

ARP37218_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Aip
Official Gene Full Name:
Aryl-hydrocarbon receptor-interacting protein
NCBI Gene Id:
11632
Protein Name:
AH receptor-interacting protein
Swissprot Id:
O08915
Protein Accession #:
NP_057875
Nucleotide Accession #:
NM_016666
Alias Symbols:
AA408703, AW476050, Ara9, D19Bwg1412e, Fkbp16, Xap2
Description of Target:
Aip may play a positive role in AHR-mediated (aromatic hydrocarbon receptor) signaling, possibly by influencing its receptivity for ligand and/or its nuclear targeting.
Protein Size (# AA):
330
Molecular Weight:
37kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Aip.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Aip.
Immunogen:
The immunogen is a synthetic peptide corresponding to a region of Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Tested Species Reactivity:
Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-Aip (ARP37218_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VAKSLRNIAEGKDPLEGQRHCCGIAQMHEHSSLGHADLDALQQNPQPLIF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Ahr; Hsp90ab1;
Blocking Peptide:
For anti-Aip (ARP37218_P050) antibody is Catalog # AAP37218 (Previous Catalog # AAPP09421)
Datasheets/Manuals:
Printable datasheet for anti-Aip (ARP37218_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...