AIL Recombinant Protein (Yersinia enterocolitica) (OPCA05124)

Catalog No: OPCA05124

Product Info

• Predicted Species Reactivity: Yersinia enterocolitica|Yersinia enterolitica
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Yersinia enterocolitica
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: ASESSISIGYAQSHVKENGYTLDNDPKGFNLKYRYELDDNWGVIGSFAYTHQGYDFFYGSNKFGHGDVDYYSVTMGPSFRINEYVSLYGLLGAAHGKVKASVFDESISASKTSMAYGAGVQFNPLPNFVIDASYEYSKLDSIKVGTWMLGAGYRF
• Protein Sequence: ASESSISIGYAQSHVKENGYTLDNDPKGFNLKYRYELDDNWGVIGSFAYTHQGYDFFYGSNKFGHGDVDYYSVTMGPSFRINEYVSLYGLLGAAHGKVKASVFDESISASKTSMAYGAGVQFNPLPNFVIDASYEYSKLDSIKVGTWMLGAGYRF
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 24-178 aa
• Tag: N-terminal 6xHis-SUMO-tagged
• Reference: Nucleotide sequence of the Yersinia enterocolitica ail gene and characterization of the Ail protein product. Miller V.L., Bliska J.B., Falkow S. J. Bacteriol. 172:1062-1069(1990)

Target Info

• Gene Symbol: AIL
• Alias Symbols: ailAttachment invasion locus protein
• Protein Name: Attachment invasion locus protein
• Description of Target: Promotes the invasion of pathogenic bacteria into eukaryotic cells by an unknown mechanism.
• Uniprot ID: P16454
• Protein Accession #: WP_005166773
• Nucleotide Accession #: NZ_KN150733
• Protein Size (# AA): Recombinant
• Molecular Weight: 33.2 kDa