AIFM1 Antibody - middle region : Biotin (AVARP02013_P050-Biotin)

Catalog No: AVARP02013_P050-Biotin

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AIFM1
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: VIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-AIFM1 (AVARP02013_P050-Biotin) antibody is Catalog # AAP30425 (Previous Catalog # AAPP01008)
• Sample Type Confirmation:

  AIFM1 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Info

• Reference: Desmots,F., (2008) J. Biol. Chem. 283 (6), 3264-3271
• Gene Symbol: AIFM1
• Gene Full Name: Apoptosis-inducing factor, mitochondrion-associated, 1
• Alias Symbols: AIF, AUNX1, CMT2D, CMTX4, COWCK, DFNX5, NADMR, NAMSD, PDCD8, COXPD6, SEMDHL
• NCBI Gene Id: 9131
• Protein Name: Apoptosis-inducing factor 1, mitochondrial
• Description of Target: AIFM1 is a flavoprotein essential for nuclear disassembly in apoptotic cells that is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it effects chromosome condensation and fragmentation. In addition, this protein induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Several alternative transcripts encoding different isoforms have been identified for this gene.This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells that is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it effects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Three alternative transcripts encoding different isoforms have been identified for this gene.
• Uniprot ID: O95831
• Protein Accession #: NP_004199
• Nucleotide Accession #: NM_004208
• Protein Size (# AA): 613
• Molecular Weight: 67kDa
• Protein Interactions: ISG15; STAU1; BAG6; UBC; NEDD8; MDM2; ASB12; RNF2; BMI1; SUZ12; PARK2; BAG3; ADRB2; HDAC11; OXSR1; ILK; PAN2; NOS2; MLH1; CFTR; ESR1; TST; FSCN1; CPOX; SHC1; FBXO6; TSC22D4; CAND1; COPS5; CUL1; CUL2; CUL3; CUL5; TONSL; BLNK; PIDD1; XIAP; AMFR; Tubb4b; Tub