AIF1 Recombinant Protein (Rat) (OPCA02585)

Catalog No: OPCA02585

Aif1 Recombinant Protein (Rat) (OPCA02585) in SDS-PAGE showing the molecular weight of approximately 18.7 kDa.

Product Info

• Predicted Species Reactivity: Rat|Rattus norvegicus
• Product Format: Liquid or Lyophilized powder
• Host: Rat
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: SQSKDLQGGKAFGLLKAQQEERLDGINKHFLDDPKYSSDEDLQSKLEAFKTKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHQKPTGPPAKKAISELP
• Protein Sequence: SQSKDLQGGKAFGLLKAQQEERLDGINKHFLDDPKYSSDEDLQSKLEAFKTKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHQKPTGPPAKKAISELP
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 2-147 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: The genomic sequence and comparative analysis of the rat major histocompatibility complex.Hurt P., Walter L., Sudbrak R., Klages S., Mueller I., Shiina T., Inoko H., Lehrach H., Guenther E., Reinhardt R., Himmelbauer H.Genome Res. 14:631-639(2004)
• Gene Symbol: Aif1
• Gene Full Name: allograft inflammatory factor 1
• Alias Symbols: AIF-1;allograft inflammatory factor 1;balloon angioplasty responsive transcript;balloon angioplasty-responsive transcript 1;Bart1;BART-1;iba1;ionized calcium binding adapter molecule 1;Ionized calcium-binding adapter molecule 1;microglia response factor;mrf-1;protein BART-1.
• NCBI Gene Id: 29427
• Protein Name: Allograft inflammatory factor 1
• Description of Target: Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play an role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation (By similarity).
• Uniprot ID: P55009
• Protein Size (# AA): Recombinant
• Molecular Weight: 18.7 kDa