Loading...
Catalog No: ARP33815_P050
Price: $0.00
SKU
ARP33815_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-AHSG (ARP33815_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Dog, Guinea Pig, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human AHSG
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 86%; Guinea Pig: 91%; Horse: 79%; Human: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: AQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTL
Concentration0.5 mg/ml
Blocking PeptideFor anti-AHSG (ARP33815_P050) antibody is Catalog # AAP33815 (Previous Catalog # AAPS19408)
ReferenceIx,J.H., et al., (2006) Circulation 113 (14), 1760-1767
Publications

Gil-Dones, F. et al. Inside human aortic stenosis: a proteomic analysis of plasma. J. Proteomics 75, 1639-53 (2012). 22178735

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). 24465277

Gene SymbolAHSG
Gene Full NameAlpha-2-HS-glycoprotein
Alias SymbolsAHS, A2HS, HSGA, APMR1, FETUA
NCBI Gene Id197
Protein NameAlpha-2-HS-glycoprotein
Description of TargetAlpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. However, its exact significance is still obscure.Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues. However, its exact significance is still obscure.Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues. However, its exact significance is still obscure. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP02765
Protein Accession #NP_001613
Nucleotide Accession #NM_001622
Protein Size (# AA)367
Molecular Weight39kDa
Protein InteractionsSUMO1; UBC; NEDD8; ATF2; ALB; VKORC1; PPP5C; FBXO2; PSMA3; GRB2; CDC42; Mad2l1; Smad3; Hsd17b7; RRAS2; INSR; DCN;
  1. What is the species homology for "AHSG Antibody - N-terminal region (ARP33815_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Dog, Guinea Pig, Horse".

  2. How long will it take to receive "AHSG Antibody - N-terminal region (ARP33815_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "AHSG Antibody - N-terminal region (ARP33815_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "AHSG Antibody - N-terminal region (ARP33815_P050)"?

    This target may also be called "AHS, A2HS, HSGA, APMR1, FETUA" in publications.

  5. What is the shipping cost for "AHSG Antibody - N-terminal region (ARP33815_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "AHSG Antibody - N-terminal region (ARP33815_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "AHSG Antibody - N-terminal region (ARP33815_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "39kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "AHSG Antibody - N-terminal region (ARP33815_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "AHSG"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "AHSG"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "AHSG"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "AHSG"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "AHSG"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "AHSG"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:AHSG Antibody - N-terminal region (ARP33815_P050)
Your Rating
We found other products you might like!