Search Antibody, Protein, and ELISA Kit Solutions

AHSG Antibody - N-terminal region (ARP33815_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33815_P050-FITC Conjugated

ARP33815_P050-HRP Conjugated

ARP33815_P050-Biotin Conjugated

Gene Symbol:
AHSG
Official Gene Full Name:
Alpha-2-HS-glycoprotein
NCBI Gene Id:
197
Protein Name:
Alpha-2-HS-glycoprotein
Swissprot Id:
P02765
Protein Accession #:
NP_001613
Nucleotide Accession #:
NM_001622
Alias Symbols:
A2HS, AHS, FETUA, HSGA
Replacement Item:
This antibody may replace item sc-120237 from Santa Cruz Biotechnology.
Description of Target:
Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. However, its exact significance is still obscure.Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues. However, its exact significance is still obscure.Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues. However, its exact significance is still obscure. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
367
Molecular Weight:
39kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express AHSG.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express AHSG.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human AHSG
Predicted Species Reactivity:
Dog, Guinea Pig, Horse, Human, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Dog: 86%; Guinea Pig: 91%; Horse: 79%; Human: 100%; Rat: 100%
Complete computational species homology data:
Anti-AHSG (ARP33815_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SUMO1; UBC; NEDD8; ATF2; ALB; VKORC1; PPP5C; FBXO2; PSMA3; GRB2; CDC42; Mad2l1; Smad3; Hsd17b7; RRAS2; INSR; DCN;
Blocking Peptide:
For anti-AHSG (ARP33815_P050) antibody is Catalog # AAP33815 (Previous Catalog # AAPS19408)
Datasheets/Manuals:
Printable datasheet for anti-AHSG (ARP33815_P050) antibody
Target Reference:
Ix,J.H., et al., (2006) Circulation 113 (14), 1760-1767
Publications:

Gil-Dones, F. et al. Inside human aortic stenosis: a proteomic analysis of plasma. J. Proteomics 75, 1639-53 (2012). WB, Dog, Guinea Pig, Horse, Human, Rat 22178735

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). WB, Dog, Guinea Pig, Horse, Human, Rat 24465277

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...