Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP33815_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33815_P050-FITC Conjugated

ARP33815_P050-HRP Conjugated

ARP33815_P050-Biotin Conjugated

AHSG Antibody - N-terminal region (ARP33815_P050)

Catalog#: ARP33815_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Dog, Guinea Pig, Horse, Human, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-120237 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human AHSG
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Dog: 86%; Guinea Pig: 91%; Horse: 79%; Human: 100%; Rat: 100%
Complete computational species homology data Anti-AHSG (ARP33815_P050)
Peptide Sequence Synthetic peptide located within the following region: AQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-AHSG (ARP33815_P050) antibody is Catalog # AAP33815 (Previous Catalog # AAPS19408)
Datasheets/Manuals Printable datasheet for anti-AHSG (ARP33815_P050) antibody
Target Reference Ix,J.H., et al., (2006) Circulation 113 (14), 1760-1767
Publications

Gil-Dones, F. et al. Inside human aortic stenosis: a proteomic analysis of plasma. J. Proteomics 75, 1639-53 (2012). WB, Dog, Guinea Pig, Horse, Human, Rat 22178735

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). WB, Dog, Guinea Pig, Horse, Human, Rat 24465277

Gene Symbol AHSG
Official Gene Full Name Alpha-2-HS-glycoprotein
Alias Symbols A2HS, AHS, FETUA, HSGA
NCBI Gene Id 197
Protein Name Alpha-2-HS-glycoprotein
Description of Target Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. However, its exact significance is still obscure.Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues. However, its exact significance is still obscure.Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues. However, its exact significance is still obscure. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P02765
Protein Accession # NP_001613
Nucleotide Accession # NM_001622
Protein Size (# AA) 367
Molecular Weight 39kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express AHSG.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express AHSG.
Protein Interactions SUMO1; UBC; NEDD8; ATF2; ALB; VKORC1; PPP5C; FBXO2; PSMA3; GRB2; CDC42; Mad2l1; Smad3; Hsd17b7; RRAS2; INSR; DCN;
  1. What is the species homology for "AHSG Antibody - N-terminal region (ARP33815_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Dog, Guinea Pig, Horse, Human, Rat".

  2. How long will it take to receive "AHSG Antibody - N-terminal region (ARP33815_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "AHSG Antibody - N-terminal region (ARP33815_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "AHSG Antibody - N-terminal region (ARP33815_P050)"?

    This target may also be called "A2HS, AHS, FETUA, HSGA" in publications.

  5. What is the shipping cost for "AHSG Antibody - N-terminal region (ARP33815_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "AHSG Antibody - N-terminal region (ARP33815_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "AHSG Antibody - N-terminal region (ARP33815_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "39kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "AHSG Antibody - N-terminal region (ARP33815_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "AHSG"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "AHSG"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "AHSG"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "AHSG"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "AHSG"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "AHSG"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:AHSG Antibody - N-terminal region (ARP33815_P050)
Your Rating