- Gene Symbol:
- AHSG
- NCBI Gene Id:
- 197
- Official Gene Full Name:
- Alpha-2-HS-glycoprotein
- Protein Name:
- Alpha-2-HS-glycoprotein
- Swissprot Id:
- P02765
- Protein Accession #:
- NP_001613
- Nucleotide Accession #:
- NM_001622
- Alias Symbols:
- A2HS, AHS, FETUA, HSGA
- Replacement Item:
- This antibody may replace item sc-120237 from Santa Cruz Biotechnology.
- Description of Target:
- Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. However, its exact significance is still obscure.Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues. However, its exact significance is still obscure.Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues. However, its exact significance is still obscure. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
- Protein Size (# AA):
- 367
- Molecular Weight:
- 39kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Affinity Purified
- Application:
- WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express AHSG.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express AHSG.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the N terminal region of human AHSG
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Dog: 86%; Guinea Pig: 91%; Horse: 79%; Human: 100%; Rat: 100%
- Complete computational species homology data:
- Anti-AHSG (ARP33815_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: AQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTL
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- SUMO1; UBC; NEDD8; ATF2; ALB; VKORC1; PPP5C; FBXO2; PSMA3; GRB2; CDC42; Mad2l1; Smad3; Hsd17b7; RRAS2; INSR; DCN;
- Blocking Peptide:
- For anti-AHSG (ARP33815_P050) antibody is Catalog # AAP33815 (Previous Catalog # AAPS19408)
- Datasheets/Manuals:
- Printable datasheet for anti-AHSG (ARP33815_P050) antibody
- Target Reference:
- Ix,J.H., et al., (2006) Circulation 113 (14), 1760-1767
- Publications:
Gil-Dones, F. et al. Inside human aortic stenosis: a proteomic analysis of plasma. J. Proteomics 75, 1639-53 (2012). WB, Dog, Guinea Pig, Horse, Human, Rat 22178735
Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). WB, Dog, Guinea Pig, Horse, Human, Rat 24465277
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
