Size:100 ul
$249.00
In stock
SKU
ARP31635_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP31635_T100-FITC Conjugated

ARP31635_T100-HRP Conjugated

ARP31635_T100-Biotin Conjugated

AHR Antibody - N-terminal region (ARP31635_T100)

Rating:
80% of 100
Catalog#: ARP31635_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-101104 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human AHR
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-AHR (ARP31635_T100)
Peptide Sequence Synthetic peptide located within the following region: MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-AHR (ARP31635_T100) antibody is Catalog # AAP31635 (Previous Catalog # AAPP02422)
Datasheets/Manuals Printable datasheet for anti-AHR (ARP31635_T100) antibody
Target Reference Marlowe,J.L., et al., (2004) J. Biol. Chem. 279 (28), 29013-29022
Gene Symbol AHR
Official Gene Full Name Aryl hydrocarbon receptor
Alias Symbols bHLHe76
NCBI Gene Id 196
Protein Name Aryl hydrocarbon receptor
Description of Target Aryl hydrocarbon receptor (AHR) is a ligand-activated transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. AHR has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. AHR ligands included a variety of aromatic hydrocarbons.
Swissprot Id P35869
Protein Accession # NP_001612
Nucleotide Accession # NM_001621
Protein Size (# AA) 848
Molecular Weight 96kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express AHR.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express AHR.
Protein Interactions GNA13; UBC; NFE2L2; MAF; RB1; EP300; ARNT; NCOA2; NCOA1; TBP; TAF9; TAF6; TAF4; NCOA7; NCOR2; BRCA1; IVNS1ABP; AIP; STUB1; AHR; FOXA1; SUMO2; DDB1; CTNNB1; TAF7; PTGES3; SMARCA4; NEDD8; XPO1; ARNTL; CCNT1; NRIP1; DAP3; AR; CUL4B; GTF2F2; RELA; HSP90AA1; E
Write Your Own Review
You're reviewing:AHR Antibody - N-terminal region (ARP31635_T100)
Your Rating