Search Antibody, Protein, and ELISA Kit Solutions

AGXT2L2 Antibody - N-terminal region (ARP47731_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP47731_P050-FITC Conjugated

ARP47731_P050-HRP Conjugated

ARP47731_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
PHYKPL
Official Gene Full Name:
Alanine-glyoxylate aminotransferase 2-like 2
NCBI Gene Id:
85007
Protein Name:
5-phosphohydroxy-L-lysine phospho-lyase
Swissprot Id:
Q8IUZ5
Protein Accession #:
NP_699204
Nucleotide Accession #:
NM_153373
Alias Symbols:
MGC117348, MGC15875, MGC45484, AGXT2L2
Description of Target:
The function remains unknown.
Protein Size (# AA):
450
Molecular Weight:
50kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express AGXT2L2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express AGXT2L2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human AGXT2L2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-AGXT2L2 (ARP47731_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QNQVLNTNSRYLHDNIVDYAQRLSETLPEQLCVFYFLNSGSEANDLALRL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PHYKPL; VAC14; USO1; SUMO1; NEDD8; POT1;
Blocking Peptide:
For anti-PHYKPL (ARP47731_P050) antibody is Catalog # AAP47731 (Previous Catalog # AAPP28582)
Datasheets/Manuals:
Printable datasheet for anti-PHYKPL (ARP47731_P050) antibody
Target Reference:
Rual,J.F., (2005) Nature 437 (7062), 1173-1178

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...