AGTPBP1 Antibody - N-terminal region (ARP55205_P050)

Catalog No: ARP55205_P050

WB Suggested Anti-AGTPBP1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AGTPBP1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: KAFIDANGMKILYNTSQLPVIPVTGPVAQLYSLPPEVDDVVDESDDNDDI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-AGTPBP1 (ARP55205_P050) antibody is Catalog # AAP55205 (Previous Catalog # AAPP33032)

Target Info

• Gene Symbol: AGTPBP1
• Gene Full Name: ATP/GTP binding protein 1
• Alias Symbols: CCP1, NNA1, CONDCA
• NCBI Gene Id: 23287
• Protein Name: Cytosolic carboxypeptidase 1
• Description of Target: NNA1 is a zinc carboxypeptidase that contains nuclear localization signals and an ATP/GTP-binding motif that was initially cloned from regenerating spinal cord neurons of the mouse.
• Uniprot ID: Q9UPW5
• Protein Accession #: NP_056054
• Nucleotide Accession #: NM_015239
• Protein Size (# AA): 1186
• Molecular Weight: 134kDa
• Protein Interactions: PNKP; NYNRIN; CYCS; CBY1; PPFIA1; PPFIA4; ENO1; UBC; DISC1; TNIK;