Catalog No: ARP47429_P050
Price: $0.00
SKU
ARP47429_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

AGPAT5 Antibody - N-terminal region (ARP47429_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-AGPAT5 (ARP47429_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Cow, Pig, Yeast
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human AGPAT5
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Human: 100%; Pig: 86%; Rat: 79%; Yeast: 77%
Peptide SequenceSynthetic peptide located within the following region: RLLSAFLPARFYQALDDRLYCVYQSMVLFFFENYTGVQILLYGDLPKNKE
Concentration0.5 mg/ml
Blocking PeptideFor anti-AGPAT5 (ARP47429_P050) antibody is Catalog # AAP47429 (Previous Catalog # AAPP28292)
ReferenceAgarwal,A.K., Arch. Biochem. Biophys. 449 (1-2), 64-76 (2006)
Gene SymbolAGPAT5
Gene Full Name1-acylglycerol-3-phosphate O-acyltransferase 5 (lysophosphatidic acid acyltransferase, epsilon)
Alias SymbolsLPAATE, 1AGPAT5
NCBI Gene Id55326
Protein Name1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon
Description of TargetMitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase. This gene contains sequences homologous to several motifs that are shared among some nuclear genes encoding mitochondrial proteins and thus may be essential for the coordinated activation of these genes during mitochondrial biogenesis. Three transcript variants encoding the same protein have been found for this gene.This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. This integral membrane protein converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis.
Uniprot IDQ9NUQ2
Protein Accession #NP_060831
Nucleotide Accession #NM_018361
Protein Size (# AA)364
Molecular Weight42kDa
Protein InteractionsUBQLN1; UBC; ELAVL1; SUMO1;
  1. What is the species homology for "AGPAT5 Antibody - N-terminal region (ARP47429_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Cow, Pig, Yeast".

  2. How long will it take to receive "AGPAT5 Antibody - N-terminal region (ARP47429_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "AGPAT5 Antibody - N-terminal region (ARP47429_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "AGPAT5 Antibody - N-terminal region (ARP47429_P050)"?

    This target may also be called "LPAATE, 1AGPAT5" in publications.

  5. What is the shipping cost for "AGPAT5 Antibody - N-terminal region (ARP47429_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "AGPAT5 Antibody - N-terminal region (ARP47429_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "AGPAT5 Antibody - N-terminal region (ARP47429_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "42kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "AGPAT5 Antibody - N-terminal region (ARP47429_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "AGPAT5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "AGPAT5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "AGPAT5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "AGPAT5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "AGPAT5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "AGPAT5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:AGPAT5 Antibody - N-terminal region (ARP47429_P050)
Your Rating