AGPAT4 Antibody - middle region (ARP60821_P050)

Catalog No: ARP60821_P050

WB Suggested Anti-AGPAT4 Antibody
Titration: 1.0 ug/ml
Positive Control: MCF7 Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AGPAT4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 85%; Guinea Pig: 85%; Horse: 92%; Human: 100%; Mouse: 85%; Pig: 100%; Rat: 85%; Zebrafish: 90%
• Peptide Sequence: Synthetic peptide located within the following region: EMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISM
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-AGPAT4 (ARP60821_P050) antibody is Catalog # AAP60821 (Previous Catalog # AAPP47007)

Target Info

• Gene Symbol: AGPAT4
• Gene Full Name: 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta)
• Alias Symbols: 1-AGPAT4, dJ473J16.2, LPAAT-delta
• NCBI Gene Id: 56895
• Protein Name: 1-acyl-sn-glycerol-3-phosphate acyltransferase delta
• Description of Target: This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. This integral membrane protein converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis.
• Uniprot ID: Q9NRZ5
• Protein Accession #: NP_064518
• Nucleotide Accession #: NM_020133
• Protein Size (# AA): 378
• Molecular Weight: 44kDa
• Protein Interactions: REL; UBC;