Loading...
Catalog No: ARP44636_P050
Price: $0.00
SKU
ARP44636_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-AGPAT2 (ARP44636_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Cow, Dog, Horse, Yeast
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 85%; Dog: 92%; Horse: 77%; Human: 100%; Yeast: 91%
Peptide SequenceSynthetic peptide located within the following region: QVPIVPVVYSSFSSFYNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALV
Concentration0.5 mg/ml
Blocking PeptideFor anti-AGPAT2 (ARP44636_P050) antibody is Catalog # AAP44636
Publications

Fetuin-A modulates lipid mobilization in bovine adipose tissue by enhancing lipogenic activity of adipocytes. J Dairy Sci. 102, 4628-4638 (2019). 30827564

Description
Gene SymbolAGPAT2
Gene Full Name1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta)
Alias SymbolsBSCL, BSCL1, LPAAB, 1-AGPAT2, LPAAT-beta
NCBI Gene Id10555
Protein Name1-acyl-sn-glycerol-3-phosphate acyltransferase beta
Description of TargetAGPAT2 is a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. The protein is located within the endoplasmic reticulum membrane and converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. Mutations in its gene have been associated with congenital generalized lipodystrophy (CGL), or Berardinelli-Seip syndrome, a disease characterized by a near absence of adipose tissue and severe insulin resistance.
Uniprot IDO15120
Protein Accession #NP_006403
Nucleotide Accession #NM_006412
Protein Size (# AA)278
Molecular Weight31kDa
Protein InteractionsABCG8; PHRF1; PHF11; ANKRD28; SLC23A2; GMPS; UBC;
  1. What is the species homology for "AGPAT2 Antibody - C-terminal region (ARP44636_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Cow, Dog, Horse, Yeast".

  2. How long will it take to receive "AGPAT2 Antibody - C-terminal region (ARP44636_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "AGPAT2 Antibody - C-terminal region (ARP44636_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "AGPAT2 Antibody - C-terminal region (ARP44636_P050)"?

    This target may also be called "BSCL, BSCL1, LPAAB, 1-AGPAT2, LPAAT-beta" in publications.

  5. What is the shipping cost for "AGPAT2 Antibody - C-terminal region (ARP44636_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "AGPAT2 Antibody - C-terminal region (ARP44636_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "AGPAT2 Antibody - C-terminal region (ARP44636_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "31kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "AGPAT2 Antibody - C-terminal region (ARP44636_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "AGPAT2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "AGPAT2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "AGPAT2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "AGPAT2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "AGPAT2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "AGPAT2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:AGPAT2 Antibody - C-terminal region (ARP44636_P050)
Your Rating
We found other products you might like!