AGFG1 Antibody - C-terminal region (ARP97722_P050)

Catalog No: ARP97722_P050

Host: Rabbit
Target Name: HRB
Sample Tissue: Human 786-0 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HRB
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: NGAGFAAFGQTKPVVTPFGQVAAAGVSSNPFMTGAPTGQFPTGSSSTNPF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-AGFG1 (ARP97722_P050) antibody is Catalog # AAP97722

Target Info

• Gene Symbol: AGFG1
• Gene Full Name: ArfGAP with FG repeats 1
• Alias Symbols: HRB, RAB, RIP
• NCBI Gene Id: 3267
• Protein Name: arf-GAP domain and FG repeat-containing protein 1
• Description of Target: The protein encoded by this gene is related to nucleoporins, a class of proteins that mediate nucleocytoplasmic transport. The encoded protein binds the activation domain of the human immunodeficiency virus Rev protein when Rev is assembled onto its RNA target, and is required for the nuclear export of Rev-directed RNAs. Multiple transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: P52594-2
• Protein Accession #: NP_001128659.1
• Nucleotide Accession #: NM_001135187.1
• Protein Size (# AA): 522
• Molecular Weight: 57 kDa