Size:100 ul
$125.00
In Stock
SKU
ARP56996_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP56996_P050-FITC Conjugated

ARP56996_P050-HRP Conjugated

ARP56996_P050-Biotin Conjugated

AFTPH Antibody (ARP56996_P050)

Catalog#: ARP56996_P050
Domestic: within 1 week delivery | International: 1 week
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the following sequence SRKPKREEHLSEEAIKVIAGLPDLTFMHAKVLMFPATLTPSTSSQEKADG
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 100%
Complete computational species homology data Anti-AFTPH (ARP56996_P050)
Peptide Sequence Synthetic peptide located within the following region: SRKPKREEHLSEEAIKVIAGLPDLTFMHAKVLMFPATLTPSTSSQEKADG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide Available upon request
Datasheets/Manuals Printable datasheet for anti-AFTPH (ARP56996_P050) antibody
Gene Symbol AFTPH
Official Gene Full Name aftiphilin
Alias Symbols Nbla10388,
NCBI Gene Id 54812
Protein Name Aftiphilin
Swissprot Id Q6ULP2
Protein Accession # NP_060127
Nucleotide Accession # NM_001002243
Protein Size (# AA) 937
Molecular Weight 102 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express AFTPH.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express AFTPH.
Protein Interactions UBC; STAT5B; LIG4; UBE3A; GGA1; GGA3; GGA2; AP1G2; AP1G1;
  1. What is the species homology for "AFTPH Antibody (ARP56996_P050)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "AFTPH Antibody (ARP56996_P050)"?

    This item is available "Domestic: within 1 week delivery | International: 1 week".

  3. What buffer format is "AFTPH Antibody (ARP56996_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "AFTPH Antibody (ARP56996_P050)"?

    This target may also be called "Nbla10388, " in publications.

  5. What is the shipping cost for "AFTPH Antibody (ARP56996_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "AFTPH Antibody (ARP56996_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "AFTPH Antibody (ARP56996_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "102 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "AFTPH Antibody (ARP56996_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "AFTPH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "AFTPH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "AFTPH"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "AFTPH"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "AFTPH"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "AFTPH"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:AFTPH Antibody (ARP56996_P050)
Your Rating