Search Antibody, Protein, and ELISA Kit Solutions

AFTPH Antibody (ARP56996_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$125.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP56996_P050-FITC Conjugated

ARP56996_P050-HRP Conjugated

ARP56996_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
AFTPH
Official Gene Full Name:
aftiphilin
NCBI Gene Id:
54812
Protein Name:
Aftiphilin
Swissprot Id:
Q6ULP2
Protein Accession #:
NP_060127
Nucleotide Accession #:
NM_001002243
Alias Symbols:
Nbla10388,
Protein Size (# AA):
937
Molecular Weight:
102 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express AFTPH.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express AFTPH.
Immunogen:
The immunogen is a synthetic peptide directed towards the following sequence SRKPKREEHLSEEAIKVIAGLPDLTFMHAKVLMFPATLTPSTSSQEKADG
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-AFTPH (ARP56996_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SRKPKREEHLSEEAIKVIAGLPDLTFMHAKVLMFPATLTPSTSSQEKADG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; STAT5B; LIG4; UBE3A; GGA1; GGA3; GGA2; AP1G2; AP1G1;
Blocking Peptide:
Available upon request
Datasheets/Manuals:
Printable datasheet for anti-AFTPH (ARP56996_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...