- Gene Symbol:
- AFM
- NCBI Gene Id:
- 173
- Official Gene Full Name:
- Afamin
- Protein Name:
- Afamin
- Swissprot Id:
- P43652
- Protein Accession #:
- NP_001124
- Nucleotide Accession #:
- NM_001133
- Alias Symbols:
- ALF, ALB2, ALBA
- Replacement Item:
- This antibody may replace item sc-74313 from Santa Cruz Biotechnology.
- Description of Target:
- AFM is a member of the albumin gene family, which is comprised of four genes that localize to chromosome 4 in a tandem arrangement. These four genes encode structurally-related serum transport proteins that are known to be evolutionarily related. AFM is regulated developmentally, expressed in the liver and secreted into the bloodstream.This gene is a member of the albumin gene family, which is comprised of four genes that localize to chromosome 4 in a tandem arrangement. These four genes encode structurally-related serum transport proteins that are known to be evolutionarily related. The protein encoded by this gene is regulated developmentally, expressed in the liver and secreted into the bloodstream.
- Protein Size (# AA):
- 599
- Molecular Weight:
- 69kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Affinity Purified
- Application:
- WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express AFM.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express AFM.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the middle region of human AFM
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Guinea Pig: 79%; Human: 100%
- Complete computational species homology data:
- Anti-AFM (ARP33804_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: GQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSR
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Blocking Peptide:
- For anti-AFM (ARP33804_P050) antibody is Catalog # AAP33804 (Previous Catalog # AAPP04870)
- Datasheets/Manuals:
- Printable datasheet for anti-AFM (ARP33804_P050) antibody
- Target Reference:
- Jerkovic,L., et al., (2005) J. Proteome Res. 4 (3), 889-899
- Publications:
Penno, M. A. S. et al. 2D-DIGE analysis of sera from transgenic mouse models reveals novel candidate protein biomarkers for human gastric cancer. J. Proteomics 77, 40-58 (2012). WB, Guinea Pig, Human 22789672
Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). WB, Guinea Pig, Human 24465277
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
