Search Antibody, Protein, and ELISA Kit Solutions

AFM Antibody - middle region (ARP33804_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33804_P050-FITC Conjugated

ARP33804_P050-HRP Conjugated

ARP33804_P050-Biotin Conjugated

Gene Symbol:
AFM
Official Gene Full Name:
Afamin
NCBI Gene Id:
173
Protein Name:
Afamin
Swissprot Id:
P43652
Protein Accession #:
NP_001124
Nucleotide Accession #:
NM_001133
Alias Symbols:
ALF, ALB2, ALBA
Replacement Item:
This antibody may replace item sc-74313 from Santa Cruz Biotechnology.
Description of Target:
AFM is a member of the albumin gene family, which is comprised of four genes that localize to chromosome 4 in a tandem arrangement. These four genes encode structurally-related serum transport proteins that are known to be evolutionarily related. AFM is regulated developmentally, expressed in the liver and secreted into the bloodstream.This gene is a member of the albumin gene family, which is comprised of four genes that localize to chromosome 4 in a tandem arrangement. These four genes encode structurally-related serum transport proteins that are known to be evolutionarily related. The protein encoded by this gene is regulated developmentally, expressed in the liver and secreted into the bloodstream.
Protein Size (# AA):
599
Molecular Weight:
69kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express AFM.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express AFM.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human AFM
Predicted Species Reactivity:
Guinea Pig, Human
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Guinea Pig: 79%; Human: 100%
Complete computational species homology data:
Anti-AFM (ARP33804_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-AFM (ARP33804_P050) antibody is Catalog # AAP33804 (Previous Catalog # AAPP04870)
Datasheets/Manuals:
Printable datasheet for anti-AFM (ARP33804_P050) antibody
Target Reference:
Jerkovic,L., et al., (2005) J. Proteome Res. 4 (3), 889-899
Publications:

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). WB, Guinea Pig, Human 24465277

Penno, M. A. S. et al. 2D-DIGE analysis of sera from transgenic mouse models reveals novel candidate protein biomarkers for human gastric cancer. J. Proteomics 77, 40-58 (2012). WB, Guinea Pig, Human 22789672

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...