Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP33804_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33804_P050-FITC Conjugated

ARP33804_P050-HRP Conjugated

ARP33804_P050-Biotin Conjugated

AFM Antibody - middle region (ARP33804_P050)

Catalog#: ARP33804_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Guinea Pig, Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-74313 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human AFM
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Guinea Pig: 79%; Human: 100%
Complete computational species homology data Anti-AFM (ARP33804_P050)
Peptide Sequence Synthetic peptide located within the following region: GQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSR
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-AFM (ARP33804_P050) antibody is Catalog # AAP33804 (Previous Catalog # AAPP04870)
Datasheets/Manuals Printable datasheet for anti-AFM (ARP33804_P050) antibody
Target Reference Jerkovic,L., et al., (2005) J. Proteome Res. 4 (3), 889-899
Publications

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). WB, Guinea Pig, Human 24465277

Penno, M. A. S. et al. 2D-DIGE analysis of sera from transgenic mouse models reveals novel candidate protein biomarkers for human gastric cancer. J. Proteomics 77, 40-58 (2012). WB, Guinea Pig, Human 22789672

Gene Symbol AFM
Official Gene Full Name Afamin
Alias Symbols ALF, ALB2, ALBA
NCBI Gene Id 173
Protein Name Afamin
Description of Target AFM is a member of the albumin gene family, which is comprised of four genes that localize to chromosome 4 in a tandem arrangement. These four genes encode structurally-related serum transport proteins that are known to be evolutionarily related. AFM is regulated developmentally, expressed in the liver and secreted into the bloodstream.This gene is a member of the albumin gene family, which is comprised of four genes that localize to chromosome 4 in a tandem arrangement. These four genes encode structurally-related serum transport proteins that are known to be evolutionarily related. The protein encoded by this gene is regulated developmentally, expressed in the liver and secreted into the bloodstream.
Swissprot Id P43652
Protein Accession # NP_001124
Nucleotide Accession # NM_001133
Protein Size (# AA) 599
Molecular Weight 69kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express AFM.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express AFM.
  1. What is the species homology for "AFM Antibody - middle region (ARP33804_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Guinea Pig, Human".

  2. How long will it take to receive "AFM Antibody - middle region (ARP33804_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "AFM Antibody - middle region (ARP33804_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "AFM Antibody - middle region (ARP33804_P050)"?

    This target may also be called "ALF, ALB2, ALBA" in publications.

  5. What is the shipping cost for "AFM Antibody - middle region (ARP33804_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "AFM Antibody - middle region (ARP33804_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "AFM Antibody - middle region (ARP33804_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "69kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "AFM Antibody - middle region (ARP33804_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "AFM"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "AFM"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "AFM"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "AFM"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "AFM"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "AFM"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:AFM Antibody - middle region (ARP33804_P050)
Your Rating
We found other products you might like!