Search Antibody, Protein, and ELISA Kit Solutions

AFM Antibody - C-terminal region (ARP33803_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33803_P050-FITC Conjugated

ARP33803_P050-HRP Conjugated

ARP33803_P050-Biotin Conjugated

Gene Symbol:
AFM
Official Gene Full Name:
Afamin
NCBI Gene Id:
173
Protein Name:
Afamin
Swissprot Id:
P43652
Protein Accession #:
NP_001124
Nucleotide Accession #:
NM_001133
Alias Symbols:
ALB2, ALBA, ALF, MGC125338, MGC125339
Replacement Item:
This antibody may replace item sc-74313 from Santa Cruz Biotechnology.
Description of Target:
AFM is a member of the albumin gene family, which is comprised of four genes that localize to chromosome 4 in a tandem arrangement. These four genes encode structurally-related serum transport proteins that are known to be evolutionarily related. AFM is regulated developmentally, expressed in the liver and secreted into the bloodstream.
Protein Size (# AA):
599
Molecular Weight:
67kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express AFM.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express AFM.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human AFM
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Pig, Rabbit
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 91%; Horse: 92%; Human: 100%; Pig: 92%; Rabbit: 92%
Complete computational species homology data:
Anti-AFM (ARP33803_P050)
Peptide Sequence:
Synthetic peptide located within the following region: HADMCQSQNEELQRKTDRFLVNLVKLKHELTDEELQSLFTNFANVVDKCC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-AFM (ARP33803_P050) antibody is Catalog # AAP33803 (Previous Catalog # AAPP04869)
Datasheets/Manuals:
Printable datasheet for anti-AFM (ARP33803_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...